Details for Chinese cabbage Locus Brara.E02471

Position : A05 ( 5`- 22095859 .. 22097501 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02471

Protein [Map View]
MDCRTRMILVLTLILMSVWGSDASAMQTTKLDAPLLTEKIATNRSIIVDIEGKGDYTSVQKAIDAVPVGNSNWIIVHVRK
GIYKERVHIPENKPFIFMRGNGRGKTVIESSQSSVDNVASATFKVEANHFVAFGITIRNDAPVGMAFTSDNQSVAAFVAA
DKVAFYHCAFFSLHNTLFDNKGRHYYHQCYIQGSIDFIFGRATSIFNNCEIFVISDKRVKPYGSITAHHRENAEENTGYV
FIRGKVYGIDEVYLGRAKGPYSRVIFAKTYFSKTVVPDGWTNWSYDGSTKDLYHAEYKCHGPGADRQRRSSWAKELTKQE
VESFLSIDFIDGTAWLPVWLQQKS*

DNA
ATGGATTGTAGAACAAGAATGATACTTGTCCTAACCCTGATTTTAATGTCCGTATGGGGTTCAGACGCATCCGCAATGCA
AACGACAAAGTTGGACGCACCGCTTTTAACTGAAAAAATCGCAACAAACAGATCGATAATTGTCGATATTGAAGGCAAAG
GAGACTACACTTCGGTTCAAAAAGCCATTGATGCTGTCCCTGTTGGTAACTCTAATTGGATTATCGTCCATGTCCGTAAA
GGAATCTACAAAGAGAGAGTGCACATTCCGGAGAACAAGCCGTTCATATTTATGAGAGGTAACGGAAGAGGAAAAACGGT
CATCGAATCATCGCAAAGTTCGGTCGATAATGTTGCTTCAGCCACTTTCAAAGTCGAAGCTAATCACTTCGTTGCTTTTG
GTATCACCATCAGGAATGATGCACCGGTCGGAATGGCGTTCACGTCTGATAACCAATCCGTGGCAGCGTTTGTGGCTGCC
GACAAAGTTGCGTTTTATCATTGTGCGTTCTTCAGCTTGCACAACACTTTGTTTGATAACAAAGGTAGACATTATTACCA
TCAGTGTTACATCCAAGGCTCTATCGACTTCATCTTCGGTCGTGCAACTTCCATTTTCAACAACTGTGAGATATTTGTGA
TATCGGACAAGAGGGTGAAACCCTACGGGTCAATCACAGCACACCACAGGGAAAACGCAGAGGAAAATACTGGTTATGTT
TTCATAAGAGGCAAAGTGTACGGAATCGATGAAGTTTACTTGGGAAGGGCCAAAGGACCGTACTCTCGGGTCATCTTTGC
CAAGACTTACTTTTCCAAGACCGTTGTCCCTGACGGTTGGACCAACTGGAGCTACGACGGCTCAACCAAGGACTTATACC
ACGCAGAGTATAAGTGTCATGGACCAGGTGCTGATAGGCAACGTAGATCAAGTTGGGCCAAAGAACTTACCAAACAAGAA
GTTGAGTCTTTCTTGTCCATTGATTTCATTGATGGAACGGCATGGCTTCCTGTTTGGCTTCAGCAAAAGTCTTAG