Details for Chinese cabbage Locus Brara.E02470

Position : A05 ( 5`- 22086742 .. 22089862 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02470

Protein [Map View]
MMKPKSIAAAFASCFLIISLLCSCISGDQNETNYEGLSYNYYEKTCPRLEEIVRSSISPMFALDPTAPAALLRLMFHDCQ
VQGCDASILIEPSGDQQFTELDSAKNFGIRKRELIGSIKTSLEVECPQQVSCSDLIILAAREAVALTGGPLIAVPLGRKD
SLSTPSKHVADSELPPSTADVDSILNLFAGIDMTIEESVAIMGSHSIGVTHCNNVLSRFDNENATSANMDPRFQTFLRVV
CPEFSPTSKTAEATFVPNDQTSLIFDTAYYDDSIAGRGNLRIDSEIGVDPRTRPFVEAFAADQDRFFNAFSSAFVKLSSY
KVLTGNNGVVRSVCDKVIKMSGHDTHQRIDHNQGNGMKKCFIERVHISNFAQGYKIV*

DNA
ATGATGAAACCAAAGAGCATAGCTGCAGCTTTTGCATCATGTTTTCTAATCATAAGCTTGTTATGCAGCTGCATTAGTGG
CGACCAAAATGAGACCAATTATGAAGGTCTATCTTACAATTACTACGAGAAAACATGTCCAAGACTCGAAGAGATCGTGA
GATCTTCAATTTCACCAATGTTTGCTCTTGATCCTACGGCTCCTGCCGCCTTGCTAAGGCTTATGTTTCATGACTGTCAA
GTTCAGGGATGTGACGCATCTATCCTAATCGAGCCAAGTGGGGACCAGCAGTTCACTGAGCTTGACTCAGCCAAGAACTT
TGGAATCAGAAAGAGGGAACTGATTGGCTCAATCAAAACCTCATTGGAGGTCGAATGTCCTCAGCAAGTCTCTTGCTCTG
ACCTCATCATCCTCGCCGCAAGAGAAGCTGTCGCTCTCACTGGTGGCCCGCTCATCGCAGTGCCATTAGGAAGAAAAGAC
TCTCTCTCTACTCCCAGCAAACACGTGGCTGACTCTGAGCTTCCTCCCTCTACTGCGGATGTCGACTCTATCTTAAATCT
CTTTGCTGGCATAGACATGACCATCGAGGAGTCCGTAGCCATTATGGGTTCACATTCAATAGGAGTGACACACTGTAACA
ACGTATTATCGCGTTTTGATAACGAAAACGCGACGAGCGCGAACATGGATCCACGTTTTCAAACGTTTTTGCGAGTTGTT
TGCCCAGAGTTTTCTCCGACATCCAAAACAGCGGAAGCTACGTTTGTTCCCAACGACCAGACTTCGTTGATCTTCGACAC
AGCTTATTACGATGATTCCATCGCGGGACGTGGTAATCTGAGAATTGACTCGGAGATTGGAGTGGACCCACGCACACGCC
CGTTTGTCGAAGCGTTTGCGGCTGATCAGGACCGTTTCTTCAACGCCTTCTCTTCCGCGTTTGTTAAATTGTCTTCTTAC
AAAGTGTTAACCGGGAATAATGGAGTAGTTAGAAGCGTGTGTGACAAGGTCATAAAAATGAGTGGGCACGATACTCATCA
AAGAATTGATCATAATCAAGGCAATGGAATGAAGAAATGTTTTATAGAAAGAGTCCATATTTCAAATTTCGCCCAAGGCT
ATAAAATAGTTTAA