Details for Chinese cabbage Locus Brara.E02465

Position : A05 ( 5`- 22058742 .. 22059471 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02465

Protein [Map View]
MKRSSAVTSPPSLSLFLLLLLPLLAQSSDDLIDKICRVTPFIDLCEASLRPLTPSPSDPKSLASAMASVVLGNMTDTLGY
IQSLIRHSHDPAAERALAQCAELYRPVVKFNIPQAIDAMRRGEFGFATYVLGDAEKQTDTCQKWINSAGADDESSVALTA
RNKQVKNLCDVAISVIKSLMKGR*

DNA
ATGAAAAGATCCTCCGCCGTCACGTCACCGCCATCTCTCTCCCTCTTTCTCCTCCTGCTCCTACCATTGCTAGCTCAATC
CTCGGACGACCTTATCGACAAAATCTGCAGAGTGACGCCGTTCATCGACCTCTGCGAAGCCTCTCTCCGCCCTCTCACTC
CCTCACCTTCCGACCCCAAGTCTCTAGCCTCGGCCATGGCTTCCGTTGTTCTTGGTAACATGACTGATACCTTAGGATAT
ATCCAATCACTGATCAGACACTCTCACGATCCTGCGGCGGAGCGAGCACTAGCTCAGTGCGCTGAGCTGTACCGGCCGGT
GGTCAAGTTCAACATTCCTCAGGCGATCGACGCAATGCGGCGAGGGGAGTTCGGGTTCGCGACGTATGTGCTCGGAGACG
CTGAGAAACAGACTGATACTTGTCAGAAGTGGATTAATAGTGCCGGTGCTGACGATGAAAGCTCGGTGGCTCTTACGGCT
AGAAACAAGCAGGTTAAGAATCTTTGTGACGTGGCTATTTCTGTGATTAAGTCTTTAATGAAGGGTCGTTAA