Details for Chinese cabbage Locus Brara.E02460

Position : A05 ( 5`- 22002357 .. 22005003 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02460

Protein [Map View]
MAMANLARRKAYLLTRNISTAPLRSSFSLSRGFASSGSDENDVVIIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCL
NVGCIPSKALLHSSHMYHEAKHVFANHGVKVSSVEVDLPAMLAQKDTAVKNLTRGIEGLFKKNKVNYVKGYGKFLSPSEV
SVETPDGETTVVKGKHIIVATGSDVKSLPGITIDEKKIVSSTGALSLSEIPKKLIVIGAGYIGLEMGSVWGRLGSEVTVV
EFAADIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDSSGDGVKLIVEPAEGGDQTTLEADVVLVSAGRSPFTSGLDL
DKIGVETDKVGRILVNERFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTYPEVASVGK
TEEQLKKDGVSYRVGKFPFMANSRAKAIDTAEGLVKILADKETDKILGVHIMSPNAGELIHEAVLAINYDAASEDIARVC
HAHPTMSEAIKEAAMATYDKPIHM*

DNA
ATGGCGATGGCGAACTTGGCTAGAAGAAAGGCTTACCTTCTCACCAGAAACATCTCCACTGCCCCTCTCAGATCCTCCTT
CTCCCTCTCCCGCGGCTTCGCTTCGTCCGGATCCGACGAAAACGATGTCGTCATCATCGGCGGCGGTCCTGGAGGCTACG
TGGCGGCGATTAAGGCCGCACAGCTCGGTCTCAAAACGACCTGCATCGAAAAACGCGGCGCTCTCGGTGGTACTTGTCTC
AACGTCGGATGTATTCCTTCAAAGGCTCTTCTTCACTCTTCTCACATGTACCACGAAGCAAAGCACGTTTTCGCTAACCA
TGGTGTCAAGGTCTCTTCCGTTGAGGTCGATCTCCCTGCCATGTTAGCTCAGAAAGACACAGCCGTCAAGAATCTCACCC
GCGGTATCGAAGGCCTCTTCAAGAAGAACAAGGTGAACTACGTTAAAGGCTACGGCAAGTTCCTCTCCCCTTCTGAAGTC
TCTGTGGAGACACCCGATGGAGAAACCACCGTTGTGAAAGGGAAGCATATCATTGTTGCAACTGGCTCGGATGTCAAGTC
TTTGCCTGGCATCACCATCGATGAAAAGAAGATTGTCTCATCGACAGGAGCACTGTCTCTGTCTGAGATACCGAAGAAGC
TGATCGTCATTGGCGCTGGCTACATTGGTCTTGAGATGGGTTCTGTGTGGGGACGGCTTGGATCAGAGGTCACAGTTGTT
GAGTTTGCAGCTGATATTGTGCCCTCTATGGATGGTGAAATCCGCAAGCAGTTTCAACGTTCGTTGGAGAAGCAGAAGAT
GAAGTTCATGCTCAAGACTAAAGTAGTTGGCGTGGATTCTTCAGGAGATGGCGTCAAGCTCATAGTGGAGCCTGCAGAAG
GTGGAGACCAGACTACTCTCGAAGCTGATGTTGTCCTTGTCTCAGCAGGAAGATCTCCCTTCACATCTGGACTTGATCTT
GACAAAATCGGAGTTGAAACTGACAAAGTAGGGAGGATCCTCGTGAACGAGAGGTTCTCAACCAACGTTTCAGGCGTTTA
CGCTATTGGAGATGTGATTCCAGGACCAATGCTGGCTCACAAAGCCGAAGAAGACGGCGTGGCTTGTGTTGAGTTTATAG
CAGGCAAACACGGACACGTGGATTACGACAAGGTCCCTGGCGTTGTCTACACATATCCCGAAGTTGCATCTGTGGGTAAA
ACCGAGGAACAGCTGAAGAAAGACGGTGTGAGCTACCGAGTTGGGAAGTTCCCGTTCATGGCTAATAGCAGAGCCAAGGC
TATTGATACAGCAGAGGGATTGGTCAAGATTTTGGCTGATAAAGAGACGGACAAGATCTTGGGAGTTCACATTATGTCGC
CAAACGCGGGAGAGTTGATCCACGAGGCGGTTCTGGCGATTAACTACGATGCGGCTAGTGAAGACATTGCTAGAGTCTGT
CACGCTCATCCCACCATGAGTGAGGCTATCAAGGAAGCTGCTATGGCTACCTACGACAAGCCCATTCACATGTAG