Details for Chinese cabbage Locus Brara.E02459

Position : A05 ( 5`- 22000101 .. 22001860 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02459

Protein [Map View]
MRASRASSLTQKWLLLTQLCLLKDLVIRCVRQFIRRAKAMLLSQNVVVVEPAEISVVVDVKSSQQDLNSFQIAQVRIRDS
VCIEIPVPEETPLLGSVKTCSVTEEDVTEFVPKISSGSYADKGSREYMEDEHICIDDLSSHLPSSFFRFPLPVAFYGVFD
GHGGSEASQYIKENATRLFFEDDVFRESHFVLNNFFLQEVEKSHREAYRLADLAMEDESIVSGSCGTTALTALVIGRHLM
VANVGDCRAVLCRGGKAVDMSFDHKSTFELERRRVEELGGYFEGEYIYGELAVTRALGDWSLKRYSSLGGSLSPLISDPE
IKQVVLTEEDEFLIMGCDGVWDVMTSQYAVTFARQGLRRHGDPRRCAMELGREAFRLNSADNVTVLVICFTSSSSTPQRR
RIQFCVSDEARASLQAMLQG*

DNA
ATGCGTGCAAGCAGAGCTTCTTCACTCACCCAAAAATGGCTGCTTTTGACACAGCTTTGTCTTCTGAAGGATCTCGTAAT
CAGATGCGTACGTCAGTTCATCAGAAGAGCTAAAGCGATGCTTCTGAGTCAAAACGTCGTCGTCGTCGAGCCTGCTGAGA
TCAGTGTCGTCGTCGACGTTAAGTCGTCTCAACAAGATCTCAATAGCTTTCAGATTGCTCAAGTTCGAATCCGTGACTCT
GTCTGTATCGAGATTCCTGTTCCTGAAGAAACGCCTCTGTTGGGATCGGTCAAGACTTGTTCTGTTACTGAAGAGGATGT
TACTGAGTTTGTCCCGAAGATAAGTTCTGGGAGTTATGCGGATAAAGGCTCGAGGGAGTACATGGAAGATGAACACATAT
GCATAGACGATCTTTCATCTCATCTTCCCTCTTCCTTCTTTAGATTCCCACTGCCCGTTGCTTTCTACGGTGTGTTTGAT
GGCCACGGTGGATCTGAGGCTTCTCAGTATATTAAAGAGAATGCAACGAGATTGTTCTTTGAAGACGATGTGTTTAGAGA
GTCTCACTTTGTTCTGAACAACTTTTTCTTGCAAGAAGTGGAGAAGTCTCACCGGGAAGCGTATAGGTTAGCTGACCTCG
CCATGGAGGATGAAAGCATTGTTAGTGGTTCGTGCGGAACAACCGCATTGACAGCTCTTGTGATCGGGAGGCACTTGATG
GTTGCTAACGTTGGTGATTGTCGGGCGGTGCTATGCAGGGGAGGGAAAGCTGTAGATATGTCGTTTGATCATAAGTCTAC
GTTTGAGCTGGAGCGGAGACGGGTGGAGGAGTTAGGAGGGTACTTTGAAGGAGAGTATATATACGGTGAGCTTGCGGTTA
CAAGAGCACTTGGAGACTGGTCATTGAAGAGGTACTCATCCTTGGGAGGTTCTTTGTCGCCTCTCATCTCAGACCCGGAG
ATTAAGCAGGTGGTTTTGACCGAGGAAGATGAGTTTTTGATAATGGGGTGTGACGGTGTTTGGGACGTGATGACGAGCCA
GTATGCTGTTACGTTTGCCAGGCAAGGGCTGAGGAGGCACGGTGACCCGAGGAGATGTGCGATGGAACTTGGAAGGGAAG
CGTTCAGGCTTAACTCGGCGGATAATGTTACAGTGTTGGTCATCTGCTTCACGTCGTCATCTTCAACTCCCCAGAGGAGA
AGAATACAGTTTTGTGTTTCTGATGAAGCCAGAGCCAGTTTGCAAGCGATGCTACAAGGCTAA