Details for Chinese cabbage Locus Brara.E02445

Position : A05 ( 5`- 21928046 .. 21929492 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02445

Protein [Map View]
MTSRLPFFIFVFLYTITTLTSKASGATSCRTSCGSIQINYPFGIDKGCGSPQFQGMLNCTSTDLDFFTPSGAYRVRSIDY
DENTMVVFDPFMSTCSILQPHHDFKLSDIQNAIIRPSYDTVFALFNCSSDSPVQNRYKSLCFEAAGHSCDELYSACTSFG
IFNTTSGNSTVRATPYCCFTSYDTVRVMSMSILDCSHYTTVIDDGKMRGVAPVDWSYGIELSYSVPEIGCDLCRKSGGTC
GFDADTEIFLCQCSDNTSPRDCGGVSDKGGCNSRSTNYAMLLLGMLVSFICAIS*

DNA
ATGACGTCAAGGCTCCCCTTCTTCATCTTTGTCTTCCTCTACACAATAACAACTCTAACATCAAAAGCCTCAGGAGCAAC
ATCTTGCCGAACATCCTGCGGCAGCATCCAAATAAACTACCCGTTCGGCATCGACAAAGGTTGTGGATCTCCACAGTTCC
AAGGAATGCTCAACTGCACCTCCACCGATCTGGATTTCTTCACTCCTTCCGGAGCATACAGGGTACGGTCAATCGATTAC
GACGAGAACACGATGGTTGTCTTCGATCCGTTCATGTCCACTTGCTCCATCCTCCAGCCTCACCACGATTTCAAACTCTC
GGATATCCAGAACGCTATTATAAGACCCTCGTACGACACCGTTTTCGCTCTCTTCAACTGCTCCAGTGACTCTCCGGTGC
AGAATCGGTACAAGAGTCTCTGCTTCGAAGCCGCCGGCCACTCCTGCGACGAGCTTTATAGCGCATGTACTTCCTTTGGC
ATCTTCAACACTACTTCTGGTAACAGTACGGTGCGTGCGACGCCGTATTGTTGTTTCACGAGCTACGATACGGTTCGTGT
GATGAGTATGAGCATCTTGGACTGTTCACATTACACGACCGTGATTGACGATGGAAAAATGAGAGGCGTGGCGCCTGTGG
ATTGGTCGTATGGAATCGAGCTTTCGTACTCGGTCCCGGAGATTGGTTGCGACCTTTGCCGGAAGTCAGGCGGCACGTGT
GGTTTCGACGCCGACACGGAGATCTTTCTTTGCCAGTGTTCCGACAACACTTCTCCAAGAGATTGTGGTGGTGTGAGTGA
TAAAGGAGGTTGCAACTCTAGAAGCACTAATTATGCTATGCTTTTGTTGGGGATGCTCGTGTCTTTTATTTGCGCAATCT
CATGA