Details for Chinese cabbage Locus Brara.E02435

Position : A05 ( 5`- 21839882 .. 21840645 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02435

Protein [Map View]
MASWKKTIATPFKKAATFFNQPQQSPQKGGRGGRMDAKAREEHERRMVQELQGEVMACGYDDVLVMWSILDKSNSSNNLT
SS*

DNA
ATGGCATCATGGAAGAAAACAATAGCAACACCGTTCAAGAAGGCAGCAACATTCTTCAACCAACCGCAGCAATCACCCCA
AAAGGGTGGCCGCGGTGGAAGAATGGATGCAAAAGCGAGAGAAGAGCACGAGAGGAGGATGGTACAAGAGCTTCAAGGAG
AAGTCATGGCTTGTGGTTACGATGATGTTCTCGTCATGTGGTCTATTCTCGACAAATCTAACTCCTCCAATAACCTCACT
TCTTCTTAA