Details for Chinese cabbage Locus Brara.E02432

Position : A05 ( 5`- 21831054 .. 21831937 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02432

Protein [Map View]
MSLQRPNGNSSSSSSPKKHKTESDEEELLMVPDMEAVGSTCVLSSNADDGVNKQEIDQTQNVTSTAKRGRGRDPVDKECR
SHKRLLRNRVSAQEARERKKVYVSDMESRANELQNNNDELEEKISILMNENTMLRKMLINTRPKADDNH*

DNA
ATGTCTCTTCAACGACCCAATGGGAACTCGAGTTCCTCTTCGTCCCCCAAGAAGCACAAAACTGAGAGTGACGAGGAGGA
GTTGTTGATGGTTCCTGACATGGAAGCAGTTGGATCAACATGTGTTCTAAGCAGCAACGCCGACGACGGAGTCAACAAAC
AGGAGATTGACCAGACCCAAAACGTAACCTCAACCGCCAAGCGGGGCCGTGGACGAGACCCAGTCGATAAAGAATGCAGA
AGCCACAAGAGATTGTTGAGGAATAGAGTATCGGCACAAGAAGCGAGGGAGAGGAAGAAAGTGTATGTGAGCGATATGGA
ATCAAGAGCTAACGAGTTGCAGAACAACAATGATGAGCTTGAGGAGAAGATCTCTATTTTGATGAACGAGAACACAATGC
TTCGCAAAATGCTTATTAACACTAGGCCTAAAGCTGACGACAATCACTAA