Details for Chinese cabbage Locus Brara.E02431

Position : A05 ( 5`- 21828414 .. 21829812 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02431

Protein [Map View]
MAYSVEGRRRASGGMLPLLALSTVAEYYRLPWKPPVTAGLLAANTLVYLRPSFIDPFIPHINEVWFNPNLILKHKDLKRF
FLSPFYHLDEPHLVYNMMSLLWKGIKLETSMGSSEFASMVFALLGMSQGVTLLLAKSLHVFFDYERAFYNEYSVGFSGVL
FALKVVLNSRDEDYTSVYGILVPTKYAAWAELVLVQMFMPSASFLGHLGGILAGILYLKLKRSSHSGLDPVSIVVRGVTR
AVTLPLRFLSSLVRSRRRRITGRGRVGRGQNGVWRCQSCTYDNSGLQSVCEMCGLGRGRGNGWSVNQRQTHSSSSDIPLD
ELRRRRVERFS*

DNA
ATGGCGTATTCTGTTGAAGGAAGAAGAAGAGCAAGCGGAGGGATGCTTCCTCTTCTGGCCCTCAGCACCGTCGCCGAGTA
CTACAGACTCCCGTGGAAACCTCCGGTGACGGCGGGTCTATTAGCCGCGAACACACTCGTCTATCTCAGACCGTCGTTTA
TCGATCCGTTCATCCCTCACATCAACGAGGTCTGGTTCAATCCAAACCTCATCCTCAAGCACAAGGACTTGAAACGCTTC
TTTCTATCACCCTTCTACCATCTAGACGAGCCTCACTTAGTCTACAACATGATGTCTCTTCTCTGGAAAGGTATCAAGCT
GGAGACATCCATGGGAAGCAGCGAGTTCGCTTCGATGGTGTTTGCGCTTCTCGGTATGTCCCAAGGAGTCACGTTGCTGT
TAGCCAAGTCTCTCCACGTGTTCTTCGACTACGAAAGAGCCTTTTACAACGAGTACTCCGTGGGATTCTCGGGAGTTCTC
TTTGCTTTGAAAGTTGTTCTCAATTCTCGGGATGAGGATTACACTAGCGTGTATGGGATCTTAGTCCCGACTAAGTACGC
TGCTTGGGCAGAGTTGGTTCTTGTGCAGATGTTTATGCCTAGCGCTTCGTTTCTTGGGCATTTAGGTGGGATTCTTGCTG
GTATTCTCTACTTGAAGCTGAAGAGGTCTTCTCACTCAGGTTTAGACCCTGTGAGTATAGTTGTTAGAGGTGTTACTCGA
GCCGTGACTTTGCCATTGAGGTTTTTGAGCAGTTTGGTTAGGTCTCGGAGGAGGAGGATAACAGGGAGAGGACGAGTGGG
GAGAGGCCAGAATGGTGTCTGGAGATGCCAGTCGTGTACTTATGACAATTCTGGTTTGCAAAGTGTTTGTGAGATGTGTG
GCTTGGGACGGGGTAGAGGAAACGGATGGTCAGTGAACCAGAGACAGACACATTCTTCTTCTAGTGATATTCCTTTGGAT
GAGCTGCGTCGTCGAAGAGTAGAGAGGTTTAGTTAA