Details for Chinese cabbage Locus Brara.E02426

Position : A05 ( 5`- 21814988 .. 21815675 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02426

Protein [Map View]
MLHQGSWFSSLMILSAIFSLTSFMLKSEGANHTVGDSSGWELLTNYTNWTQGREFHVGDVLVFNYNKDQHNVMQVNSTAY
ADCGRDNYISLFTNGNDSIIISEVGEHWFICAMYDHCENGQKLSINATL*

DNA
ATGCTTCATCAGGGAAGCTGGTTCTCCAGCTTGATGATACTCTCTGCCATTTTCTCTTTAACTTCGTTCATGCTAAAGTC
TGAAGGAGCAAACCATACAGTTGGCGACAGCTCTGGCTGGGAACTCTTGACAAACTATACCAACTGGACACAGGGAAGAG
AGTTTCATGTCGGCGATGTCTTAGTTTTCAACTACAACAAGGACCAGCATAACGTTATGCAAGTTAACTCTACCGCTTAC
GCAGATTGTGGAAGAGATAATTACATCTCTCTCTTCACCAACGGCAACGACTCAATAATTATATCAGAGGTTGGAGAGCA
CTGGTTCATCTGTGCAATGTACGATCATTGTGAGAATGGCCAGAAGCTAAGTATTAATGCAACTCTTTGA