Details for Chinese cabbage Locus Brara.E02418

Position : A05 ( 5`- 21776731 .. 21781531 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02418

Protein [Map View]
MSKTPEKGEGEQNTTGLFPLFPTQANSVSAISSAPQWLRNASFTTDLSVIDAAPSTAPSLPDVEASEEEEEGYAYRNNTE
ANQPRVYDLVEEEEGSESDDDDKAKKKKKKQKRDSDEYYTKPTKDYYLDTRPDPDNLAYGSIYRMNVPRYKLDNSQRGSE
SGSTKLYLRNRRGSMLEAEIDVNSLDGKAKSDNRYWYAKNAAMERNKNFRRIRLSASREAVDSSFDHFIPLEEGEAVQES
EEEDVESKESVVGTSWEDEVLNKTREFNRQTRERPHDEKAWLAFADFQDKVSSMQSQKGVRLQTLEKKISILEKAFELNP
DSEELLLALLKAYRSRDSADVLISRWEKALMQNSSSYKLWREFLRVVQGEFSRFKVSEVRKMYSYAIQALFSACSKRHRQ
MDATSEPLDSALIQQELVLVDMLVSLCRFEWQAGYRELATALFQAEMEYSIFSPSLLLSEQSKLRLFEHFWSSNGARVGE
EGAFGWSLWLEKEEEHRQKMLKEESSDDNDVGGWTGWTEQLSDRKEDSIIASANIGEGDVNRDREGLDEEMEDENGMPED
DTEAMLKLLGIDVDAAASDEVKDTSTWVKWFEEEVSRDQNQWMPTRKAGELSSVDEMGEREDEEQLSSLVLYEDINGYLF
SLRSNEARLSLVYQFVDFFGANISPWTSSNSLWWIEKINSLETLSDSMLEILRNVHECLSKSDSANGFSLGSLLGSNSDI
SMRTEMMKFLRNAILLCLNVFPRNYILEEAVLVAEELFVTNMKTCEVATTPCQALAKRLLKSDRQDLLLCGVYAQREAAS
GNMKQARRIFDMALTSICGLPKELQDNSPLLYLWYAESEVANSSGSSRETESSSRAMHILCYLGSGLAYVPYTSQPSSMQ
ILRARQGFREKLKKIQSLWSHGVTDDQSAALVCSAALFEELTNDLSGAVEILEHMFSSVLPGRRSQSHQLEILFNYYVRM
LQRHQDDLTLSKLWNPISEGMQLYPLSPELYQALIDICNHRMTSHRLRMMFDDYSRKTPSVVVWLFALSYELSRGGSLHR
IRGLFERALAQDTLNSSVILWRCYIAYEIDIAHNPSAARRIYFRAINACPWSKKLWLDGFGKLSTVLTAKEMSDLQEVMR
DKELNIRTDIYEILLLQG*

DNA
ATGTCGAAGACACCAGAGAAGGGCGAGGGCGAACAGAATACCACAGGCTTGTTCCCGCTCTTCCCTACTCAGGCGAACTC
CGTCTCTGCTATTTCATCTGCTCCTCAATGGCTTCGCAACGCCAGCTTCACGACGGATCTCTCCGTCATCGACGCCGCAC
CTTCGACGGCTCCTTCCCTACCCGATGTCGAGGCTAGCGAAGAAGAGGAAGAAGGATACGCTTATAGAAACAATACTGAA
GCTAATCAGCCTAGAGTTTACGATTTGGTTGAAGAAGAAGAAGGATCCGAGTCTGATGACGACGACAAGGCGAAGAAGAA
GAAGAAGAAGCAGAAGAGGGATTCTGATGAGTACTATACGAAGCCTACCAAGGATTATTACTTGGATACTCGTCCTGATC
CAGATAATCTTGCTTATGGTTCCATCTACAGGATGAATGTTCCTCGTTATAAACTTGATAATTCTCAGAGAGGTTCTGAG
TCAGGTTCTACGAAGCTGTATCTAAGGAATAGGCGTGGTTCTATGCTTGAAGCAGAGATTGATGTTAATTCTTTAGACGG
GAAAGCAAAGTCTGATAATAGATACTGGTATGCAAAGAATGCAGCCATGGAACGGAACAAGAATTTCAGGCGTATTCGTT
TATCTGCTTCTAGAGAGGCTGTTGATTCGTCCTTTGATCATTTCATTCCTCTGGAGGAAGGTGAAGCTGTTCAAGAAAGC
GAGGAGGAAGATGTGGAGTCTAAAGAGTCAGTGGTGGGAACGTCGTGGGAGGATGAGGTGTTGAATAAGACCCGAGAGTT
TAACAGGCAGACGAGGGAACGTCCTCATGATGAGAAGGCGTGGCTGGCATTTGCTGATTTTCAAGATAAGGTTTCGAGTA
TGCAGTCTCAGAAAGGAGTTCGCTTGCAGACTTTGGAGAAGAAGATTAGTATTCTTGAGAAGGCTTTTGAACTGAACCCA
GATAGTGAAGAACTGTTGCTTGCGCTTCTCAAGGCGTACCGAAGCAGAGACAGCGCAGATGTGCTGATCAGTAGGTGGGA
AAAAGCACTTATGCAGAATTCCTCAAGCTACAAGTTGTGGAGGGAGTTTCTACGTGTTGTTCAAGGGGAGTTCTCCAGAT
TTAAAGTATCAGAAGTGAGGAAGATGTATTCTTATGCAATCCAGGCACTCTTTTCTGCTTGCAGCAAGCGACATAGGCAG
ATGGATGCAACATCTGAACCACTGGATTCTGCTCTCATCCAGCAGGAACTTGTTCTAGTGGATATGCTAGTTAGCCTCTG
CAGGTTTGAATGGCAGGCAGGTTACCGGGAGCTGGCCACAGCGTTATTTCAAGCTGAAATGGAATATAGCATCTTTTCTC
CATCTTTGTTGCTAAGTGAACAGAGTAAATTAAGACTGTTTGAGCACTTTTGGAGCAGTAATGGTGCTAGAGTTGGAGAA
GAAGGAGCTTTTGGATGGTCTTTGTGGTTGGAGAAAGAGGAGGAACACAGGCAAAAAATGTTGAAAGAGGAATCATCTGA
TGACAATGACGTAGGCGGTTGGACAGGTTGGACAGAGCAATTGTCAGATAGGAAAGAAGACAGTATTATTGCTTCAGCTA
ACATTGGAGAAGGTGATGTTAATCGGGATCGGGAGGGCCTGGACGAAGAGATGGAAGACGAGAATGGCATGCCTGAAGAT
GACACTGAAGCTATGTTAAAGCTATTAGGCATTGATGTCGATGCTGCGGCCAGTGATGAGGTTAAAGATACTTCAACATG
GGTCAAATGGTTTGAAGAAGAGGTTTCTCGAGATCAAAATCAATGGATGCCTACTCGAAAAGCTGGTGAACTCTCAAGTG
TTGATGAAATGGGCGAGAGAGAAGATGAAGAGCAACTGTCAAGTCTTGTACTATATGAGGATATAAATGGATATCTATTT
TCATTACGTTCAAACGAGGCGCGCTTATCTCTGGTATACCAGTTCGTTGATTTCTTCGGTGCGAATATCTCCCCATGGAC
ATCAAGCAACAGTTTGTGGTGGATTGAGAAAATAAATAGTCTTGAAACATTGTCAGATTCTATGCTGGAAATTTTGAGAA
ATGTTCATGAGTGTTTGTCGAAATCAGATAGTGCCAACGGTTTCAGCTTGGGATCTCTTTTAGGTAGCAACAGTGACATA
TCTATGCGGACCGAGATGATGAAGTTTCTCCGCAATGCCATCTTGCTTTGTCTGAATGTTTTTCCGCGAAACTACATTTT
GGAAGAAGCTGTGCTTGTTGCAGAAGAGCTATTTGTAACAAACATGAAAACATGTGAAGTCGCAACAACCCCATGCCAAG
CTTTGGCCAAACGTCTCCTGAAAAGTGACCGGCAGGATCTACTACTTTGTGGAGTTTATGCTCAGCGAGAAGCTGCTTCT
GGAAATATGAAACAAGCTAGAAGAATCTTTGACATGGCTCTGACTTCTATCTGTGGCCTCCCTAAGGAACTACAGGATAA
CTCTCCATTGCTATATTTATGGTATGCCGAATCAGAAGTAGCCAATAGTAGTGGCAGCAGTCGAGAAACAGAATCATCAT
CTCGTGCTATGCACATTCTGTGCTATCTGGGAAGTGGTCTAGCGTATGTTCCTTATACTTCCCAGCCTTCAAGCATGCAG
ATCCTTAGAGCACGCCAGGGGTTCAGAGAGAAGCTTAAGAAGATACAGTCATTATGGTCTCATGGTGTCACAGATGATCA
ATCAGCAGCGCTTGTTTGTTCGGCAGCTCTATTTGAGGAGCTAACGAATGACCTTTCGGGTGCTGTTGAGATCCTGGAAC
ACATGTTCAGTTCCGTTCTTCCAGGAAGAAGAAGTCAAAGTCATCAACTTGAAATCCTGTTCAATTATTACGTGAGAATG
CTTCAGAGGCATCAGGACGACCTAACTTTGTCAAAACTGTGGAACCCCATATCAGAGGGAATGCAACTGTATCCTCTCAG
TCCCGAGCTTTATCAAGCTTTAATAGACATCTGTAATCATCGTATGACATCCCATAGACTGAGAATGATGTTTGATGACT
ACTCCCGCAAAACTCCATCCGTAGTTGTTTGGCTATTTGCGCTTTCTTATGAGTTGAGTAGAGGAGGCTCCCTACACAGA
ATCCGTGGATTGTTTGAAAGGGCATTGGCACAAGATACACTGAACAGCTCGGTGATTCTATGGCGTTGCTACATTGCATA
TGAAATCGACATCGCACACAATCCATCAGCAGCTAGGAGGATTTACTTCCGAGCTATAAATGCTTGCCCATGGTCGAAAA
AACTATGGCTGGATGGGTTTGGGAAGCTGAGCACAGTACTGACGGCGAAAGAGATGTCAGATTTACAAGAAGTGATGCGA
GACAAGGAACTCAACATTAGGACAGATATTTACGAGATTCTTCTTTTGCAGGGTTGA