Details for Chinese cabbage Locus Brara.E02414

Position : A05 ( 5`- 21760480 .. 21764812 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02414

Protein [Map View]
MVYAAKKFINDPSDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADVSAEKYDKVAVISGGGSGHEPAHAGYVGEGMLTA
AICGDVFASPPVDSILAGIRAVTGPQGCLLIVKNYTGDRLNFGLAAEQAKSEGYKVETVIVGEDCALPPPRGIAGRRGLA
GTVLVHKVAGAAAAAGLSLEKVASEAKCASEMVGTMGVALSVCTLPGQVTSDRLGQEKMELGLGIHGEPGAAVVDVQPVD
VVVSHVLQQILSPETSYVPITRGNRVVLMVNGLGGTPLMELMIAAGKAVPKLQLEFGLAVDRVYTGLFMTSLDMAGFSIS
IMKADQSILDRLDAPTKAPNWPVGTDGNRPPAKIPVPIPPSRSAKSAESQARPKELSQQGRVLEAAIQAAATVIISLKDS
LNEWDGKVGDGDCGSTMHRGATAILEDMKHYYPLNDAAETVNEIGASISRAMGGTSGIIYNLLCKAAYAELKANTDSEVT
PKYWSKALKSSIASVSKYGGATAGYRTMLDALIPASQVLEEKLSAGEDPIRAFILSAEAATKGAESTIQMQAQAGRSSYV
SAEMLATVPDPGAMAAAGWYSAAARAVKEQYQGSS*

DNA
ATGGTTTACGCGGCGAAGAAATTCATCAACGACCCCAGCGATGTTGTGACTGAGTTCATCGAGGGACTTGTGGAAACTTA
TCCTGGACTGCAGTATTTGGATGGCTTTCCTGAGGTTAAGGTGGTGCTACGAGCTGATGTCTCTGCTGAGAAGTATGATA
AGGTTGCTGTTATATCAGGTGGAGGCAGTGGGCATGAGCCAGCTCATGCTGGTTACGTTGGAGAAGGAATGCTTACAGCT
GCTATCTGCGGAGATGTCTTTGCTTCTCCACCTGTTGATTCCATCCTGGCTGGGATTCGGGCTGTCACTGGTCCTCAGGG
ATGTCTTTTGATCGTCAAGAACTATACTGGTGACCGTTTGAACTTTGGTTTGGCTGCTGAGCAAGCGAAATCTGAAGGTT
ACAAAGTAGAGACTGTAATTGTTGGAGAGGATTGCGCTTTACCCCCGCCTCGTGGTATTGCTGGACGCAGAGGGTTAGCA
GGAACCGTTCTTGTACATAAGGTGGCTGGCGCAGCAGCAGCGGCTGGTCTTTCTCTAGAAAAAGTTGCGTCCGAGGCGAA
GTGTGCGTCGGAGATGGTTGGTACCATGGGTGTTGCATTATCTGTTTGTACGCTTCCTGGGCAGGTTACATCTGATCGTC
TGGGCCAAGAGAAGATGGAACTCGGGCTTGGAATTCATGGAGAACCTGGTGCTGCTGTGGTTGACGTTCAACCTGTGGAC
GTGGTGGTTTCACATGTTCTTCAGCAGATACTGAGTCCTGAGACCAGTTATGTTCCCATTACACGCGGTAACAGAGTGGT
TCTAATGGTTAATGGCTTAGGAGGCACCCCTTTGATGGAACTTATGATTGCTGCTGGAAAAGCTGTCCCTAAACTGCAGC
TGGAATTTGGACTTGCTGTTGATAGGGTGTACACAGGGCTTTTTATGACTTCGCTTGATATGGCAGGATTCTCGATTTCA
ATCATGAAGGCTGACCAGTCAATCTTAGACCGATTAGATGCTCCAACTAAGGCTCCAAATTGGCCTGTTGGCACTGATGG
CAACCGGCCACCTGCAAAGATCCCTGTTCCTATACCCCCTTCTCGATCAGCAAAAAGCGCTGAGTCTCAGGCTCGACCTA
AAGAGCTGAGTCAACAAGGTCGAGTTCTTGAGGCAGCTATTCAAGCAGCAGCAACTGTGATCATCAGTCTAAAGGATAGT
TTGAACGAATGGGATGGAAAAGTAGGCGATGGTGATTGTGGGTCAACAATGCACAGAGGTGCAACAGCTATTCTGGAAGA
CATGAAACACTATTATCCGCTCAATGATGCTGCGGAAACAGTGAATGAGATTGGTGCATCAATCAGCAGAGCCATGGGGG
GCACAAGTGGAATTATATACAATCTCCTCTGCAAGGCGGCGTACGCGGAGCTAAAAGCTAACACTGATTCGGAAGTCACT
CCCAAATACTGGTCCAAAGCACTCAAGTCATCAATAGCTTCTGTCAGCAAATATGGTGGAGCAACTGCGGGATACAGGAC
GATGCTAGATGCGCTTATCCCAGCTTCACAAGTTCTTGAAGAGAAGCTAAGCGCTGGAGAGGACCCAATACGTGCTTTTA
TTCTGTCAGCTGAAGCAGCAACTAAAGGAGCGGAATCAACCATACAGATGCAAGCACAGGCTGGGAGATCGAGCTATGTG
TCTGCAGAGATGCTTGCAACAGTTCCAGATCCAGGTGCAATGGCTGCAGCAGGATGGTACAGTGCGGCAGCAAGGGCCGT
GAAGGAGCAGTATCAGGGGTCATCATGA