Details for Chinese cabbage Locus Brara.E02412

Position : A05 ( 5`- 21750720 .. 21752177 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02412

Protein [Map View]
MNSRRSLTSATAATMSFLLYICTTVVVTNGELQRFIEPAKSDGSVSFITIGDWGRRGDFNQSKVAYQMGRVGEKIGLDFV
VSTGDNFYDNGLFSEYDPNFKESFSNIYTAPSLQKQWYSVLGNHDYRGDSEAQLSSVLREIDRRWICLRSFVVDAELVEI
FFVDTTPFVKEYYTEEDGHTYDWRAVPSRNSYVKSLLRDLQASLKRSKATWKIVVGHHAMRSIGHHGDTKELIEELLPIM
KEYGVDLYMNGHDHCLEHISDEDSPIQFLTSGAGSKAWRGDVDPTTNNPKSVRFYYDGQGFMSARFTHTDAEIVFYNVFG
EVLHKWVTSKQLLLSSV*

DNA
ATGAATTCTCGTCGATCGTTAACGTCCGCTACGGCGGCGACTATGAGTTTTCTATTGTATATCTGCACCACCGTAGTCGT
CACAAACGGTGAGCTTCAGAGATTTATCGAACCGGCAAAGAGCGACGGTTCCGTTAGTTTTATAACCATCGGAGATTGGG
GTCGCCGTGGCGACTTCAACCAGTCTAAAGTCGCTTATCAGATGGGAAGAGTTGGAGAAAAGATAGGTTTAGATTTCGTG
GTGTCCACGGGAGATAACTTCTACGACAATGGATTGTTTAGTGAATACGATCCAAACTTCAAAGAGTCTTTCTCTAACAT
CTACACTGCTCCGAGTCTTCAGAAACAGTGGTACAGTGTCTTGGGGAACCATGATTATAGAGGTGACTCAGAGGCTCAGC
TAAGCTCTGTTCTCAGAGAAATCGACAGACGTTGGATCTGTCTCCGATCATTCGTAGTCGACGCTGAGTTAGTCGAGATC
TTCTTCGTTGACACAACTCCCTTCGTTAAAGAATACTACACAGAAGAAGACGGTCACACGTACGACTGGCGTGCGGTCCC
ATCTCGCAACTCTTACGTCAAGTCTCTCCTCCGTGACCTCCAAGCTTCCTTAAAAAGATCCAAGGCCACGTGGAAGATCG
TCGTTGGTCACCACGCCATGAGAAGCATTGGTCACCATGGAGACACTAAAGAGCTAATCGAGGAGCTTCTTCCGATTATG
AAAGAGTACGGTGTTGATCTTTATATGAACGGACACGACCATTGTCTTGAACATATCAGTGACGAAGACAGTCCTATTCA
GTTTCTGACAAGCGGTGCTGGTTCCAAGGCTTGGAGAGGAGATGTTGACCCGACCACCAACAATCCAAAGTCTGTGAGAT
TCTATTACGATGGTCAAGGGTTCATGTCTGCTAGATTCACTCACACGGATGCAGAGATTGTCTTCTACAATGTCTTTGGT
GAGGTTTTGCACAAATGGGTTACTTCTAAACAGCTTCTTCTTTCATCTGTTTGA