Details for Chinese cabbage Locus Brara.E02411

Position : A05 ( 5`- 21748550 .. 21750439 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02411

Protein [Map View]
MDAAATASLIRSSVLPRKASDNGAGSMFLTASGPGFTRSGPGRQLRFRQNAFARFSRPLQSSTARRSFVVRASASNDDAS
SSAAKPIAPLQLESPAGQFLSQILVTHPHLVPAAVEQQLEQLQTDRDSEGQNKDASSVPGTDIVLYRRIAELKENERRKT
LEEILYALVVQKFMEANVSLVPSITPSSSDPSGRVDTWPTKVEKLEKLHSSEMYEMIHNHLALILGPRMGDLASVAQISK
LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKLLTGGLDESKTSVEQPENVTFKAVSSHPEVGSFAGGVSAKGFGSEIKPS
RLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLW
DVESHVDARYHFVLN*

DNA
ATGGACGCCGCCGCGACCGCGAGTTTGATCCGATCTTCCGTCTTACCGCGTAAAGCATCCGACAACGGTGCTGGATCTAT
GTTCCTCACGGCCAGTGGCCCTGGGTTCACGCGTTCTGGTCCTGGACGTCAACTTCGTTTCAGGCAAAACGCGTTTGCTA
GATTCTCGAGACCGTTGCAAAGCTCAACAGCTCGGAGAAGCTTTGTGGTTAGAGCTTCAGCATCTAATGATGATGCCTCC
TCCTCTGCTGCTAAACCAATCGCGCCGCTTCAGCTGGAGTCTCCTGCTGGTCAGTTTCTTTCTCAGATTCTGGTGACTCA
TCCTCATCTCGTCCCTGCCGCTGTTGAGCAGCAGCTTGAGCAGCTCCAAACTGATCGTGACTCCGAGGGACAGAACAAAG
ATGCTTCGTCCGTACCTGGAACCGACATCGTTCTCTACAGGAGAATCGCTGAGTTGAAGGAAAACGAGAGACGAAAGACA
CTGGAAGAGATTCTTTACGCATTAGTGGTTCAAAAGTTCATGGAAGCTAACGTATCACTTGTACCATCGATCACCCCATC
ATCATCAGACCCATCTGGTCGCGTTGATACTTGGCCTACCAAAGTAGAGAAACTCGAGAAGCTTCACTCCTCCGAGATGT
ACGAGATGATCCACAACCATTTAGCCTTAATCCTCGGTCCCAGAATGGGCGACCTGGCTTCCGTCGCACAGATAAGCAAA
CTCAGAGTCGGTCAAGTCTACGCTGCCTCCGTCATGTACGGATACTTCTTGAAGCGGGTGGACCAGAGGTTTCAGCTCGA
GAAGTCGATGAAGCTTCTCACAGGTGGGTTGGATGAGAGTAAAACAAGCGTGGAGCAGCCAGAGAACGTGACGTTTAAAG
CTGTGTCGTCTCACCCGGAGGTCGGTTCGTTTGCGGGTGGTGTTAGTGCTAAAGGGTTTGGTAGCGAGATTAAACCGTCC
AGGTTAAGGACGTACGTGATGTCGTTTGATAGCGAGACGCTTCAGAGATACGCTACTATAAGATCAAGAGAAGCAGTTGG
GATCATTGAGAAGCATACGGAGGCGTTGTTTGGTAAGCCTGAGATTGTGATTACTCCTGAAGGCACGGTTGATTCTTCCA
AGGACGAGCAGATTAAGATCAGCTTTGGTGGAATGAAGAGGCTTGTCTTGGAGGCTGTGACTTTTGGTTCGTTTCTTTGG
GACGTTGAGAGCCATGTAGATGCAAGGTACCACTTTGTATTGAACTGA