Details for Chinese cabbage Locus Brara.E02410

Position : A05 ( 5`- 21743074 .. 21745412 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02410

Protein [Map View]
MASMSSALTRFSGLSSKTTLSPDFDHSSRRTFLPPNRVGLKISSSSSSETDSEPDLSVTVNGLKMPNPFVIGSGPPGTNY
TINFSCPHGMPERRMGAAVGQDCALLEEVCGWINAKATVPVWAKMTPNITDITEPARVSLKSGCEGIAAINTIMSVMGID
LKTLHPEPCVEGYSTPGGYSYKAVRPIALAKVMNIAQMMKSEFGGKDYSLSGIGGVETGYDAAEFILLGSNTVQVCTGVM
VHGYGHVKTLCAELQDFMKQHNFSTIEDFRGHSLQYFTTHTDLVRRQKEAIEQRKAERKGLKSDKDWTGDGFVKETESMV
SN*

DNA
ATGGCATCCATGAGTTCCGCCTTGACTCGCTTCTCCGGACTCTCTTCTAAAACCACCTTATCACCGGACTTCGATCACTC
CTCTCGCCGGACTTTTCTACCTCCGAACAGAGTCGGTCTCAAGATCTCCTCTTCTTCTTCTTCCGAAACAGACTCCGAGC
CTGATCTGAGTGTCACCGTAAACGGCCTGAAAATGCCGAATCCGTTCGTGATCGGGTCGGGTCCACCCGGTACCAACTAC
ACCATCAACTTCTCGTGTCCTCATGGTATGCCAGAGCGTAGAATGGGAGCAGCTGTGGGACAAGACTGTGCACTTCTGGA
GGAGGTTTGCGGTTGGATTAATGCTAAAGCTACTGTTCCTGTTTGGGCTAAGATGACTCCTAATATCACTGACATTACTG
AGCCGGCTAGGGTATCTCTAAAATCAGGATGTGAAGGGATTGCAGCCATCAATACAATCATGAGTGTGATGGGAATCGAT
CTGAAGACACTGCATCCTGAGCCATGCGTTGAAGGTTACTCAACTCCAGGAGGTTACTCTTATAAGGCTGTTCGCCCAAT
CGCGCTTGCGAAAGTTATGAACATTGCTCAAATGATGAAGTCTGAGTTTGGTGGGAAAGATTACTCGCTTTCCGGTATTG
GAGGTGTTGAAACTGGCTATGACGCAGCTGAGTTCATTCTCCTCGGATCAAATACTGTTCAGGTATGCACTGGTGTGATG
GTGCATGGCTATGGTCATGTGAAAACCCTATGCGCTGAGCTTCAAGATTTCATGAAACAACACAACTTCTCGACAATAGA
AGACTTCAGAGGGCATTCTCTTCAGTACTTTACAACACACACAGATTTAGTCAGGAGACAGAAAGAAGCTATTGAGCAGC
GAAAAGCCGAGAGGAAAGGCTTGAAATCTGATAAAGATTGGACCGGTGATGGGTTCGTGAAGGAGACTGAAAGTATGGTT
TCTAACTAA