Details for Chinese cabbage Locus Brara.E02406

Position : A05 ( 5`- 21707102 .. 21709936 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02406

Protein [Map View]
MSRSTLIPSLNPAHSFRLQFPLSNPSFSSPPSFLRVRRCGNRRRGVTMSAGKDHYKTLNVGKNATLKEIKSAYRALARKY
HPDMNKNPGAEDKFKQISAAYEVLSDEEKRSAYDRFGEAGLDGNFNASQDASQGVDPFDLYSAFFGGGSDGFFGDMGDSG
GMGFDFMNKRSMDLDIRYDMRLSFEESVFGVKREIEVSYLATCDGCGGTGAKSSKDVKQCSNCGGKGRVMDTQRTPFGIM
SQVSTCSKCGGDGRIITDKCRMCNGNGRLRSSKKMDLVVPPGVSDRATMRMRGEGNVDKRSGRAGDLFIVLQVAEKRGIR
REGLNLYSKITIDFTDAILGTFTKVETVEGTMDLRIPPGTQPGDTVKLYRKGVPDTDRPSVRGDHCFEVKVSIPKNLSER
ERKLVEEFSLIRRSSSSTETCQEEHRYDSESREKPSLWQKMKSFIRPEDSRTKFGTMSLNSSVPLQRIKETGTSTVFTFL
ALCVIASAVAFVQKKGNRLKEKKEI*

DNA
ATGTCTCGCTCTACTTTGATTCCATCTCTAAACCCAGCTCACAGCTTCCGTCTTCAGTTCCCGCTATCCAATCCTTCATT
CTCTTCGCCTCCCAGTTTTCTGCGTGTTCGGCGATGCGGAAATCGCCGCCGTGGGGTCACCATGTCCGCCGGGAAGGATC
ACTACAAAACTCTGAATGTCGGCAAAAACGCCACCTTGAAGGAGATCAAGAGCGCGTACAGAGCACTCGCTCGCAAGTAT
CATCCGGACATGAACAAGAACCCTGGGGCTGAAGATAAGTTCAAACAGATTAGTGCTGCTTATGAGGTTTTATCTGATGA
GGAGAAGAGATCCGCGTATGATCGCTTTGGCGAGGCTGGTTTAGATGGTAATTTCAATGCTTCACAGGATGCTTCTCAAG
GAGTGGACCCATTTGATTTGTATAGTGCATTCTTTGGAGGTGGTTCTGATGGATTCTTTGGGGATATGGGTGATTCTGGA
GGCATGGGTTTTGATTTCATGAACAAGAGAAGCATGGACCTTGACATCCGGTATGATATGCGGTTGAGCTTTGAAGAGTC
TGTTTTTGGAGTTAAACGTGAGATTGAGGTTTCTTATTTAGCAACGTGTGATGGCTGTGGAGGAACAGGTGCTAAATCTA
GTAAGGACGTTAAACAGTGTAGCAACTGTGGTGGTAAAGGGCGTGTCATGGACACTCAGAGAACACCCTTTGGAATCATG
TCTCAGGTTTCCACTTGCTCAAAATGTGGTGGTGATGGGAGAATCATAACTGATAAGTGTAGAATGTGCAATGGCAACGG
GAGACTACGGTCTAGTAAAAAGATGGATCTTGTTGTCCCTCCTGGTGTCAGCGACAGAGCCACAATGCGGATGCGAGGAG
AAGGTAACGTGGACAAGAGAAGTGGACGAGCTGGAGATCTGTTCATCGTGCTTCAGGTTGCTGAGAAGCGTGGGATCCGG
AGGGAAGGGCTTAATCTATACTCCAAGATCACCATAGATTTCACAGATGCAATACTTGGGACATTCACAAAGGTAGAAAC
AGTTGAGGGAACAATGGATCTTCGGATTCCGCCTGGAACTCAGCCAGGTGACACTGTGAAATTATATAGGAAAGGAGTTC
CAGACACGGACAGACCTTCTGTTCGAGGTGATCATTGCTTTGAAGTGAAGGTTTCGATCCCCAAAAACCTAAGCGAGAGG
GAACGCAAGTTGGTAGAGGAATTCTCGTTGATTAGAAGATCTAGCAGTAGTACTGAAACTTGTCAAGAGGAGCATAGATA
TGACTCAGAGTCCAGAGAAAAACCGTCTTTGTGGCAAAAAATGAAGAGTTTCATAAGACCAGAAGATTCAAGGACGAAGT
TTGGGACAATGAGCTTGAACTCATCAGTGCCACTACAAAGAATTAAAGAGACAGGGACTTCGACTGTTTTCACGTTTTTG
GCTCTGTGCGTTATAGCCTCGGCTGTTGCGTTTGTTCAGAAAAAGGGTAATCGCTTGAAAGAAAAGAAAGAAATCTAA