Details for Chinese cabbage Locus Brara.E02403

Position : A05 ( 5`- 21674225 .. 21677317 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02403

Protein [Map View]
MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSKKGSAASSQFLSFRPSQDDRHRKPGNYHLPHSGSFMPSSVA
ADVYDSNRNTPYSSVQGARMFPNSHQQQESITVSMARPGLQSHYAPGGKSFMSNGVNSQPFVGVPIMAPPISVLPAPGSI
VGTTDIRSSSKPLGSPAQLTVFYAGSVCVYDDISPDKAKAIMLLAGNGSSMPQAFSPPQTHQQVAHHARASVDSSAMPPS
FMPTVSYLSPEAGSSTNVLGARGFASTYHNNQTNASTVKPQTVALPQARKASLARFLEKRKERVTSVSPYCLDKKSPTDC
RTPISECISSSFSSAT*

DNA
ATGGAGAGAGATTTTCTCGGGCTCGGTTCGAAAAATTCGCCGATCACTGTGAAGGAGGAAACAAGCGAAAGCTCCAGGGA
TTCAGCTCCGAATAGAGGAATGAATTGGTCATTCTCAAAGAAAGGCTCTGCTGCTTCTTCTCAGTTTCTATCGTTCAGGC
CATCTCAAGATGACAGACATAGAAAGCCTGGAAACTACCATCTGCCTCACTCTGGTTCCTTCATGCCATCATCAGTAGCA
GCAGATGTGTATGATTCTAACCGGAACACTCCTTACAGTTCTGTACAGGGAGCCAGGATGTTCCCTAACTCCCATCAACA
GCAAGAATCTATCACAGTGTCCATGGCCAGGCCGGGTCTCCAGTCCCATTATGCACCAGGAGGAAAAAGCTTCATGAGCA
ATGGCGTAAACTCGCAACCTTTTGTAGGAGTTCCTATCATGGCACCTCCAATCTCAGTCCTTCCTGCTCCAGGTTCCATT
GTAGGGACAACTGATATTAGATCTTCTTCCAAGCCATTAGGATCACCAGCTCAGTTGACCGTCTTTTATGCCGGTTCAGT
TTGTGTTTATGATGACATATCTCCTGATAAGGCCAAGGCGATAATGTTGCTAGCTGGAAACGGTTCCTCTATGCCTCAAG
CCTTCTCACCACCTCAAACTCATCAACAGGTGGCCCATCATGCTCGTGCATCTGTTGATTCTTCAGCTATGCCTCCTAGC
TTCATGCCTACAGTCTCTTATCTTAGCCCTGAAGCTGGAAGTAGCACAAATGTACTCGGAGCAAGAGGCTTTGCATCAAC
ATACCATAACAACCAAACTAATGCATCTACTGTAAAGCCTCAAACAGTGGCTTTACCTCAGGCTCGCAAAGCATCTCTGG
CTAGGTTTTTAGAGAAACGCAAAGAAAGGGTCACAAGTGTATCGCCATATTGCTTGGACAAGAAGTCACCAACAGACTGT
CGTACGCCAATATCTGAATGCATAAGTTCGTCATTCAGCTCTGCAACCTAA