Details for Chinese cabbage Locus Brara.E02401

Position : A05 ( 5`- 21669993 .. 21670815 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02401

Protein [Map View]
MRRLPPWMTAVASSGVTAASNRTDEGEIKQEAEAPKTKKKRKTRRERDDSEEHKKVEIRRRGRVGRKIKEEEAKASIGND
VKSPEIIQSVTSPEDEEDLTVDDLLSFAQEYVKGEEEDQALPTSESMVVDVNDGSNMKASRGETNRTRDPTSDDMISLLL
GPFFNTRK*

DNA
ATGAGGCGGTTACCACCGTGGATGACCGCCGTCGCGTCCTCCGGTGTAACAGCTGCAAGCAATAGAACAGACGAGGGTGA
AATAAAACAGGAAGCAGAAGCTCCCAAGACCAAGAAGAAGCGTAAAACTCGAAGAGAGAGAGATGACTCAGAGGAACACA
AAAAGGTGGAGATCAGGAGAAGAGGAAGAGTTGGTAGGAAAATCAAAGAAGAGGAGGCTAAGGCTAGTATTGGCAACGAT
GTTAAGAGTCCCGAGATTATTCAATCCGTGACTAGTCCAGAAGATGAGGAGGATCTCACGGTTGATGATTTATTAAGCTT
TGCTCAAGAGTACGTCAAAGGTGAGGAAGAAGACCAGGCATTACCAACGTCTGAATCAATGGTGGTTGATGTCAATGATG
GATCAAACATGAAAGCTTCTCGAGGAGAAACAAATAGAACCAGAGATCCAACATCAGATGACATGATCAGTTTGCTACTG
GGTCCTTTTTTCAATACTCGAAAATAA