Details for Chinese cabbage Locus Brara.E02399

Position : A05 ( 5`- 21647598 .. 21653016 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02399

Protein [Map View]
MAIVTGDRYLENLEKFLEGNADSLIDATDVLKLNPAGLHYVHLRLESLREVERMLSGAPVDYLRAYVSDIGDYRALEQLR
RILRLLPSLKVVSSLPSPARDPTPLSLLPFARLKVLELRGCDLSTSSAKGLLELRHTLEKLICHNSTDALRHVFASRIAE
IKDSPQWNKLVFVSCACNRLLLMDESLQLLPAVESLDLSRNKFAKVDNLRRCSKLKHLDLGFNQLRKISHLSEVSCHLVK
LVLRNNALTTLRGIENLKSLEGLDVSFNIISDFSELEFLGSLSFLTDLWLEGNPFCCARWYRANVLSYVARPNDLKLDGK
QIGNREFWKRQVVVTRRKTQPASYGFYSPAREEADDEGSFNRKKSQAKIYRLASIDTEEESTYVNSDQESASCELETQSK
EENIKSDHEDDIFGLISKVEKLKKERSVLWLREVKEWMDHPSEDFVDVRKDGWSIDSEKKYYTKNGKNSKHHKEALRYPP
GPLPGFQITDLNQKDQAYLLDGKPDEKGNMSTLDATHDITGSFSPSTYMQSPPHYQKDVLHRRHNLVEEILQLSADSYSV
ASSDSSSSCSENENYDSEQSNPEQDMLVDHLNENSPGEEILGSEKGTSLLDSQPEKSSIIKTWRIDESFKAKTNNIISGL
HNSELASGVNHIYNWFDKRKSKRQPKKRVVSLLVDNSVISSGETSHRSDADISDSGEDGCVSDHLQEGSLTMGCNSKRTT
RFWGAEKTPEVMGGLVDEYITTTLSDSSIDETCRIYVCCDCVLRQESTYTQQEVVLLRSSQDKLCVLFVDVSTDSQDRNL
SLLCSHAINDIQDVSVGLGLQVVRLRFKEGTEYIFKTESIEKTTVLLNITKVLDSQATESKCLGSLENIQMEMFEKEICG
GLKLSIFQYSVLHFQRSTLGEVSWLPRSLFVVDGHLFICIEDFRLLSSLPKDTSSAPYFSLDSSCSISDIFEMVTSLFIL
AFCSHCRFSPSFLMYENLSIIQAIESRGSSCLSLKIKQKNSTFQARPNRTATSATWKLKLFSIECVLKFVSLVKGLHPDS
PELPLLVRHLG*

DNA
ATGGCGATCGTGACGGGAGATCGATACCTAGAGAATCTCGAGAAGTTCCTCGAAGGAAACGCCGATTCGCTCATCGACGC
CACCGATGTACTCAAGCTCAACCCCGCGGGCCTTCACTACGTTCATCTCCGTCTCGAATCTCTCCGCGAGGTCGAGCGTA
TGCTCTCCGGAGCTCCCGTTGACTATCTCCGCGCCTACGTCTCCGACATCGGCGATTACCGCGCCTTGGAGCAGCTCCGA
CGTATCCTCCGCCTCCTCCCTTCTCTCAAAGTCGTCTCCTCGCTTCCTTCGCCGGCTCGTGATCCCACGCCGCTCTCTCT
TCTTCCGTTTGCTAGGCTTAAGGTTTTGGAGCTGCGCGGGTGTGATTTGTCCACTTCGTCTGCTAAGGGGTTGCTCGAAC
TGAGGCATACCTTGGAGAAGTTGATCTGCCACAATTCCACTGATGCGTTGCGGCATGTGTTTGCTAGTAGAATTGCCGAA
ATAAAGGATTCACCACAGTGGAATAAGTTGGTTTTCGTTTCTTGCGCTTGTAACCGTCTCTTGCTCATGGATGAGTCGTT
GCAACTTCTCCCAGCTGTTGAGTCGCTTGATCTGAGTCGGAACAAGTTTGCGAAGGTGGATAATCTTCGGAGGTGTTCCA
AGCTGAAGCACCTTGATCTAGGTTTCAATCAACTTAGAAAAATCTCTCACTTGAGCGAGGTATCATGTCACCTTGTTAAA
CTTGTTTTGAGGAACAACGCTCTAACTACATTGCGTGGGATTGAGAATTTGAAGTCACTTGAAGGCCTTGATGTTTCCTT
CAATATTATTTCAGACTTCTCAGAATTGGAATTCCTTGGGAGTCTTTCATTCTTGACAGACTTGTGGTTGGAAGGAAATC
CGTTTTGCTGTGCTCGATGGTACAGGGCAAATGTCCTCAGCTACGTTGCTCGCCCAAATGATTTAAAGCTAGATGGCAAA
CAAATTGGGAATAGAGAATTTTGGAAGAGGCAGGTTGTTGTTACCCGTAGGAAAACACAGCCTGCTAGCTATGGGTTCTA
CTCTCCCGCTAGAGAGGAAGCTGATGATGAAGGAAGCTTCAATAGAAAAAAGTCACAGGCGAAAATCTACCGGCTCGCGT
CTATTGACACTGAGGAAGAGAGCACTTATGTAAATTCTGACCAAGAGTCTGCTTCATGTGAACTCGAGACTCAAAGCAAA
GAGGAGAATATCAAGTCCGATCACGAAGATGATATCTTTGGTCTAATAAGTAAAGTTGAAAAGTTGAAGAAAGAACGTTC
GGTTCTTTGGCTGCGAGAGGTTAAGGAGTGGATGGATCATCCGTCAGAGGATTTTGTGGATGTCAGAAAAGACGGCTGGA
GTATTGATTCAGAGAAAAAGTACTACACAAAGAATGGAAAAAACTCGAAGCATCACAAGGAAGCATTGAGATATCCACCA
GGGCCTTTACCAGGTTTCCAAATTACAGATCTAAATCAGAAGGATCAAGCATATCTTCTTGATGGGAAGCCAGATGAAAA
AGGAAACATGTCAACATTGGATGCTACTCACGATATAACAGGATCATTTTCACCCTCAACATATATGCAATCACCCCCTC
ACTATCAAAAGGATGTCTTACACCGACGTCATAACCTGGTGGAAGAAATCTTGCAGCTATCAGCAGATTCTTACTCAGTA
GCATCGTCTGATAGCTCGAGCAGCTGCAGTGAAAATGAAAATTATGACTCTGAGCAATCAAACCCTGAACAAGATATGTT
GGTGGATCATCTTAATGAGAATAGCCCCGGCGAGGAGATTCTGGGATCTGAAAAAGGCACAAGCTTGCTTGATTCTCAAC
CAGAAAAAAGTAGCATAATAAAGACTTGGAGGATAGATGAATCGTTCAAAGCAAAGACCAATAATATTATTTCTGGACTA
CATAATAGTGAGCTTGCTTCCGGTGTTAATCATATTTATAATTGGTTTGACAAAAGGAAAAGCAAGAGGCAGCCTAAAAA
GAGAGTTGTTTCTCTATTGGTGGATAATAGTGTCATAAGTAGCGGAGAAACATCTCATAGAAGTGATGCTGATATCAGTG
ATTCTGGTGAAGATGGGTGTGTTTCTGATCATTTGCAAGAAGGTTCATTGACTATGGGTTGTAATAGTAAGAGAACTACT
AGATTTTGGGGTGCCGAAAAAACCCCTGAAGTAATGGGTGGTTTAGTGGACGAGTATATTACAACAACGCTGTCAGATTC
CAGCATTGATGAGACTTGTAGGATTTACGTATGTTGTGATTGTGTACTACGGCAAGAATCCACCTACACGCAACAGGAAG
TAGTGCTGCTGCGGAGTAGCCAAGATAAATTGTGTGTGCTGTTCGTGGATGTTTCTACTGATTCACAAGATAGAAATTTA
AGTTTATTGTGTTCGCATGCTATAAATGATATACAAGATGTCTCAGTTGGGCTAGGACTTCAAGTTGTGAGGCTACGCTT
TAAGGAGGGCACGGAGTACATTTTCAAAACAGAGAGCATCGAGAAAACAACAGTTTTACTCAATATCACTAAAGTGTTGG
ATTCTCAAGCTACGGAATCTAAATGTTTGGGAAGTTTGGAGAATATTCAAATGGAAATGTTTGAGAAAGAAATATGTGGT
GGTTTAAAGTTGAGTATATTCCAGTACAGTGTTCTCCATTTTCAGAGAAGCACTCTTGGAGAGGTGTCATGGCTTCCACG
GTCACTATTTGTGGTAGATGGACATCTTTTCATATGCATTGAAGACTTCAGGCTGCTGAGTTCTCTGCCAAAGGATACTT
CTTCGGCTCCATATTTCTCACTTGACTCGAGCTGCTCCATCTCCGACATTTTTGAGATGGTAACAAGTTTGTTTATTCTT
GCTTTTTGCTCACACTGTCGTTTTTCCCCTTCTTTTTTGATGTATGAAAACTTGAGTATCATCCAGGCTATTGAATCCCG
GGGAAGCTCATGCTTGTCACTGAAGATCAAGCAGAAGAATTCCACATTTCAAGCCAGACCAAACAGAACAGCGACTTCAG
CAACATGGAAGCTCAAATTATTCAGCATCGAGTGTGTACTCAAATTCGTGTCTCTAGTCAAAGGACTTCACCCGGATTCA
CCAGAACTCCCGTTGCTCGTAAGGCATTTGGGTTAG