Details for Chinese cabbage Locus Brara.E02396

Position : A05 ( 5`- 21640648 .. 21642594 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02396

Protein [Map View]
MADQTKNDNTPGIFELNNGSLQVKISNYGATITSLSVPDKNGKLADVVLGFDSVDPYVNGLAPYFGCIVGRVANRIKEGK
FSLNGVDYTLPINNGPNSLHGGNNGFDKKTWEVAGHKKDGDKPFITFKYHSADGEEGYPGAVTVTATYTLTSATTMRLDM
EAVPENKDTPINLAQHTYWNLSGHDSGNILDHRIQIWGSHITPVDQHSVPTGELLPVKGTPFDFTEEKRIGERIGEVGIG
YDHNYVLDCADQEKDGLKHAAKLRDGESSRVMDLWTDAPGVQFYTGNYVDGVVGKGNAVYGKHAGVCLETQGFPNAINQK
SFPCVVVKAGEKYKHTMLFEFSA*

DNA
ATGGCAGATCAGACCAAGAATGATAATACTCCTGGGATCTTCGAGCTAAACAATGGATCCTTGCAGGTCAAGATCTCAAA
TTATGGCGCCACCATCACCTCCTTGTCTGTCCCCGACAAGAACGGGAAACTGGCTGATGTTGTTCTCGGATTCGACTCGG
TGGATCCATATGTGAACGGGCTTGCACCATACTTTGGGTGCATAGTTGGTCGTGTAGCAAATCGGATCAAAGAGGGCAAG
TTTAGTCTCAATGGAGTCGACTACACTTTGCCCATCAACAATGGTCCCAATAGCCTCCACGGTGGTAACAATGGTTTCGA
TAAGAAGACATGGGAAGTCGCAGGACACAAGAAAGACGGTGACAAACCTTTCATCACATTCAAATATCACAGCGCCGATG
GAGAAGAAGGTTATCCCGGTGCGGTTACTGTCACGGCCACATACACTCTCACGTCAGCAACAACCATGAGACTTGATATG
GAAGCAGTTCCGGAGAACAAAGACACTCCAATCAACTTAGCTCAGCATACATACTGGAACTTATCGGGTCACGACTCAGG
AAACATTCTTGACCACAGGATCCAAATCTGGGGTTCTCATATCACTCCCGTGGATCAACACTCAGTCCCTACAGGTGAGC
TCTTGCCGGTGAAAGGAACTCCATTCGATTTCACCGAGGAGAAACGTATAGGCGAGCGTATAGGAGAGGTGGGGATTGGA
TACGATCACAACTACGTGTTGGACTGTGCTGATCAAGAGAAGGACGGGCTGAAACACGCGGCGAAGCTAAGAGACGGTGA
GAGCTCAAGGGTGATGGACTTGTGGACCGATGCTCCGGGTGTGCAGTTTTATACGGGGAACTATGTGGATGGAGTGGTGG
GGAAAGGGAATGCGGTTTATGGGAAGCATGCAGGTGTGTGCCTTGAGACGCAGGGGTTCCCGAACGCGATTAACCAGAAG
AGTTTCCCGTGTGTTGTGGTCAAGGCTGGTGAGAAGTATAAGCACACGATGTTGTTTGAGTTTTCAGCTTGA