Details for Chinese cabbage Locus Brara.E02393

Position : A05 ( 5`- 21628915 .. 21632111 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02393

Protein [Map View]
MAASYEAERDVQKSYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIA
LDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNIADGSIDLIFSNWLLMYLSDKEVELLVERMVGWIKVGGYIFFRESC
FHQSGDSKRKSNPTHYREPRFYTKVFQECVTRDAAGNSFGLSMIGQKCIGAYVKNKKNQNQICWIWQKVSSENDRGFQRF
LDNVQYKSSGILRYERVFGQGFVSTGGIETTKEFVEKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHVVGIDLSVNMISF
ALERAIGLNCSVEFEVADCTTKHYPENSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEY
IKQRGYDLHDVQAYGQMLKEAGFNDVIAEDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGE
QKWGLFIANKN*

DNA
ATGGCAGCATCGTACGAAGCAGAGCGTGACGTCCAGAAGAGTTACTGGATTGAGCATTCGGCTGATCTCACTGTTGAAGC
TATGATGCTCGACTCTCGTGCTGCTGATCTCGACAAGGAAGAACGCCCTGAGGTGCTCTCTTTGCTTCCACCCTATGAAG
GCAAGTCGGTGCTGGAGCTTGGAGCTGGTATTGGTCGTTTCACTGGTGAATTGGCTCAGAAGGCTGGTGAACTCATTGCT
CTTGACTTCATTGATAGCGTCATCAAGAAGAATGAGAGTGTCAATGGGCACTACAAGAATGTGAAGTTTATGTGTGCTGA
TGTTACATCCCCTGACCTTAACATCGCTGATGGATCCATTGACTTGATTTTCTCCAACTGGCTTCTCATGTATCTCTCTG
ACAAAGAGGTGGAGCTTTTGGTAGAAAGGATGGTTGGTTGGATCAAAGTCGGAGGATACATTTTCTTCCGAGAATCTTGC
TTCCACCAATCTGGTGACAGCAAGCGCAAATCCAACCCCACTCACTACCGTGAACCCCGTTTCTATACCAAGGTATTTCA
AGAATGTGTGACACGAGATGCTGCTGGGAACTCATTTGGGCTCTCCATGATCGGGCAAAAGTGCATTGGAGCTTATGTGA
AGAACAAGAAGAATCAGAATCAGATTTGCTGGATTTGGCAGAAAGTCAGCTCAGAGAATGACAGAGGCTTCCAACGTTTC
TTGGACAACGTTCAGTACAAATCCAGTGGGATCCTACGCTATGAGCGTGTCTTTGGACAAGGCTTTGTGAGCACTGGTGG
AATCGAGACAACCAAAGAGTTTGTGGAGAAAATGGATCTGAAACCAGGACAGAAAGTGTTAGATGTTGGTTGTGGCATTG
GTGGAGGTGACTTCTACATGGCTGAGAACTTCGATGTCCATGTCGTTGGTATCGATCTCTCAGTCAACATGATTTCGTTC
GCACTGGAACGTGCTATTGGACTCAACTGCTCGGTTGAGTTTGAGGTCGCGGATTGCACCACAAAACATTACCCTGAGAA
TTCCTTCGATGTCATTTACAGCCGTGACACTATTCTGCACATCCAAGACAAACCAGCTTTGTTCAGGACTTTCTTCAAGT
GGCTTAAACCGGGAGGCAAAGTGCTCATCAGCGACTACTGTAAGAGCTCGGAAACTCCATCTCCTGAGTTTTCTGAGTAC
ATTAAACAGAGAGGATATGATCTCCATGATGTTCAAGCTTATGGGCAGATGCTAAAAGAGGCAGGCTTTAATGATGTGAT
CGCAGAGGATCGTACTGATCAGTTTATGCAAGTCCTGAGACGTGAACTAGAGAGGGTGGAGAAAGAAAAGGAAGAGTTCA
TCTCTGACTTCTCCAAAGAGGACTATGAGGACATAGTTGGAGGATGGAAGGCGAAGCTGGAGAGAAGTGCTTCGGGTGAG
CAGAAGTGGGGACTTTTCATCGCCAACAAGAACTAA