Details for Chinese cabbage Locus Brara.E02391

Position : A05 ( 5`- 21602405 .. 21604508 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02391

Protein [Map View]
MFFISRLGARENGFYHTFFSKRLSFSTTSVFHLKKTHDHVLDPRVEEDALEEEDRRRSVTDRAYWRRRIHNLCTLRKSPD
EALRIIDGLCLRGYRPDSLNLSSVIHALCDAGRFEEAHRRCLLFVASGFVPDERTCNVIIARLLDSGDPVSTLRVVHRLI
GVKREFVPSLTNYNRLINQMCLMNRVRDAHKLVFEMRSRGHRPNVVTYTTLIGGYCEIREIEVAHKVFDEMRACGVRPNC
LTLSVLIGGFLKRRDLEVGRKMMEELWGEMKDETDASVKSAAFANLVDSLCREGYFNDVFEIAEDMPQCDSVNVEFAYGH
MMDSLCRYKRNHGAARIVYIMKCKGLKPISTSYNAIIHGLCKDDGCMRAYQLLEEGSEFGFFPSEYTYKLLVESLCKEHD
TGKARNVLELMLRKEGTDRNRIYNIYLRALCVVDNPTEILNVLVSMLQGDCRPDEYTLNTVIDGFCKMGRVDDAMKVLGD
MMTGKFCAPDAVTLTTVMCGLLTQGRAEEALDVLNRVMPENGFKPSIVTYNAVMRGLFKLRKGDEAMRVFDQMSKAGVIA
DNTTYAIIIDGLCVTAQVDTAKRFWDDAYQIIEEMRKNGRAPDAVTWRILDKLHDSRALAVEGE*

DNA
ATGTTCTTCATCTCTCGCCTGGGAGCCAGAGAAAATGGCTTCTACCATACCTTCTTCTCCAAGCGCCTCTCTTTCTCCAC
TACCTCCGTATTCCACCTGAAGAAAACTCATGATCATGTTCTTGACCCTCGAGTAGAAGAAGATGCACTAGAAGAAGAAG
ACCGTCGACGCAGCGTAACCGACAGAGCTTACTGGAGAAGACGGATACACAATCTCTGCACCCTACGTAAAAGCCCCGAC
GAGGCTCTTCGAATCATCGACGGCCTTTGCCTCCGCGGATACCGCCCCGACTCGCTTAACCTCAGCAGCGTGATCCACGC
TCTCTGCGACGCCGGAAGATTCGAAGAAGCTCACCGTCGCTGTCTCCTCTTCGTCGCTTCGGGGTTCGTCCCCGACGAAC
GTACCTGCAACGTCATCATCGCGAGGCTGCTCGATTCGGGGGATCCGGTGAGCACGTTGAGGGTTGTGCATCGGTTGATC
GGTGTCAAGAGAGAGTTCGTGCCGTCGTTGACGAATTATAACCGTTTGATTAATCAGATGTGTTTGATGAATAGAGTGAG
GGATGCGCATAAGCTTGTGTTTGAGATGAGGAGCAGAGGGCATAGACCCAATGTCGTGACGTACACGACTCTGATCGGTG
GGTACTGCGAGATTCGTGAGATTGAAGTTGCGCATAAGGTGTTCGACGAAATGCGTGCGTGTGGCGTGAGGCCTAACTGT
CTCACGCTGAGTGTTCTTATTGGTGGGTTTTTGAAAAGGAGAGATCTTGAAGTAGGAAGGAAGATGATGGAGGAGCTTTG
GGGAGAGATGAAGGATGAGACTGATGCATCAGTGAAGTCAGCAGCTTTTGCGAATCTGGTTGATTCTTTGTGCAGGGAAG
GTTATTTCAACGACGTTTTCGAGATTGCAGAGGATATGCCACAGTGTGATTCCGTGAACGTTGAGTTTGCTTACGGGCAT
ATGATGGATTCGTTGTGTCGGTATAAGAGGAACCATGGAGCTGCGAGGATTGTTTATATCATGAAGTGTAAAGGGTTAAA
ACCTATAAGCACGTCTTACAATGCTATTATTCATGGGTTGTGTAAGGATGATGGATGTATGAGAGCTTATCAGTTGCTAG
AAGAGGGATCTGAGTTTGGTTTCTTCCCGTCTGAGTATACTTATAAGCTCTTAGTGGAGAGTCTATGTAAGGAGCATGAC
ACTGGTAAGGCGAGGAATGTTCTAGAGCTGATGTTGAGAAAAGAAGGAACAGATAGAAATAGAATCTATAATATCTATCT
ACGTGCTCTTTGCGTAGTGGATAATCCGACAGAGATCCTGAATGTTCTGGTCAGTATGCTTCAGGGAGACTGTAGGCCCG
ATGAGTATACACTTAACACAGTCATTGATGGATTTTGCAAGATGGGTAGGGTGGATGATGCCATGAAAGTTCTTGGCGAT
ATGATGACAGGGAAGTTCTGCGCACCTGATGCTGTGACTTTAACTACTGTTATGTGTGGCTTGCTTACACAAGGAAGAGC
AGAAGAAGCTCTTGATGTGTTGAATCGAGTTATGCCTGAGAATGGGTTTAAGCCAAGTATTGTTACATACAACGCTGTTA
TGCGTGGATTGTTCAAGCTCCGTAAGGGAGATGAAGCTATGCGTGTGTTTGATCAGATGTCGAAGGCGGGTGTGATCGCA
GATAATACTACATATGCTATTATCATTGACGGGTTGTGTGTGACTGCTCAGGTGGATACGGCGAAGAGGTTCTGGGACGA
TGCGTACCAGATTATAGAGGAGATGAGGAAGAACGGTCGGGCTCCTGATGCTGTCACATGGCGGATACTTGATAAACTAC
ATGATTCCAGAGCTTTAGCAGTGGAAGGAGAGTAA