Details for Chinese cabbage Locus Brara.E02384

Position : A05 ( 5`- 21487113 .. 21493435 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02384

Protein [Map View]
MFHHAPSFIFLIFFLTILSPVSPNQDLVTVQPFLVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACTGKKLHKGK
CCPVLGAWLYSAYSTTALSRSIPSSAVRNATTPEEDMPLLPDDSETCVDGLEKSLRRRGIELASPNETCGVVDCYCGIRL
HHLSCSEAFSVDGEGRLVGDESVDRLETDCLSVRNNNGDRFSPLSRCNNLSNNKCLNSLYKLNPKKTSGTRNPSKEDRNR
TTKMHNKDCVLMGLTWLLAKNRTAYFPTVTSVLRAVMLNQNGEPRSCALGGDGMPLAVDSSEFSNGSSTLIQYPYHLVHF
LLYSVITLVLLGSW*

DNA
ATGTTCCATCACGCGCCGTCTTTCATTTTCCTCATCTTCTTCCTCACCATTCTATCACCCGTCTCACCAAACCAAGACCT
GGTCACCGTCCAGCCATTCCTGGTCAAATCATCCCCACCCGCCACCATCCCCGCTTTCCCGGAGCAATCCGACTTCTCCG
GCTGCCCACTCGATCTACCAGAAGACCTCTTCCACGGAATCAAGTCAGCCTGCACCGGCAAAAAGCTCCACAAAGGAAAA
TGCTGCCCCGTGCTAGGCGCGTGGCTCTACTCCGCTTACTCGACCACTGCTCTCAGCCGTTCCATTCCCAGCTCCGCCGT
TAGAAACGCGACCACGCCGGAAGAGGATATGCCTTTGCTTCCAGACGACTCGGAGACTTGCGTCGATGGTTTGGAGAAAT
CTCTGAGGAGGAGAGGGATCGAGCTGGCGAGTCCGAACGAGACGTGCGGCGTGGTTGACTGCTACTGCGGGATAAGGTTG
CATCACTTGAGCTGTTCCGAGGCGTTTAGTGTGGATGGAGAAGGGAGGCTCGTTGGAGACGAGAGTGTTGATCGGTTAGA
GACTGATTGTTTGAGTGTAAGAAACAACAATGGCGATAGATTCTCTCCGCTAAGTAGATGTAACAACTTATCCAACAACA
AGTGCTTGAACAGCCTCTATAAGCTTAACCCGAAGAAAACATCAGGGACAAGAAACCCATCCAAGGAAGACAGAAACAGA
ACAACAAAGATGCACAACAAAGACTGTGTCCTAATGGGTCTCACTTGGCTTCTCGCTAAGAACCGTACGGCTTACTTCCC
CACTGTCACTTCAGTCCTCCGAGCCGTCATGCTCAACCAAAACGGTGAGCCACGGTCATGTGCTCTCGGCGGTGACGGCA
TGCCTTTAGCTGTTGACTCTTCCGAATTCTCTAACGGCTCATCAACTTTAATTCAGTACCCGTACCACTTGGTCCACTTC
TTACTTTACAGCGTCATCACATTGGTCTTGCTGGGGTCGTGGTGA