Details for Chinese cabbage Locus Brara.E02381

Position : A05 ( 5`- 21466456 .. 21470016 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02381

Protein [Map View]
MILSGRKSSFLDQGKQAGESVGLHENSAIAPLDPTCQSSSFPEAAQDFVEAIRRNRAYQKFLRKKLTEIEAKIEQNEKHQ
KNVKIVVDFQASCKRITKQALSQGKDPRLQLISTPKCGPRDSSEDNDKKISPLTFGPSENSCVENYRMAIKNYPVSVNRR
SWSTEENENLAKGLKQQLQETLLNEAIERYSDLEGSSDDIETINESIKNLEITPEMMRQFLPKVNWDQLASMYVKDRSAA
ECEARWMSSEDPLINHDPWTAEEENNLRVIIQEKGFTDWLDIAVSLGTNRTPFQCLARYQRSLNADILRKEWTAEEDDQL
RAAVELYGEKDWQTVANALEGRAGTQCSNRWKKTLHPTRTRVGKFSSDEEKRLKVAVTLFGAQNWHKIARFVPGRTSTQC
REKWANCLDPNVNHGKWSKEEDAKLREAMAEHEIGNWSKIASHVPRRTDNQCRRRWMQLYPHQVPLLQEATRLRKEAIVG
NFVDRESQRPALLECKFLALPEIPLEPEPEIVAVKKKRKARPKKADAECESEVSSAAKERRPKRRRKGLERCSGDVCRQE
NETVCENIENLDNGGEVRSLEWYKENQDNVKEKKQRRRRKSVAETSNNSTVTTDCSQVKVGVKKLTPRRKVSAVVPVENQ
DAPN*

DNA
ATGATTCTCTCGGGAAGAAAAAGCAGCTTTCTAGATCAGGGGAAACAAGCTGGTGAATCTGTTGGTTTACATGAAAACTC
TGCCATTGCTCCTCTTGACCCGACATGCCAATCATCAAGTTTCCCTGAAGCTGCACAAGACTTTGTTGAGGCTATCCGGA
GGAACAGGGCGTATCAGAAGTTTCTTAGAAAGAAACTGACTGAAATTGAAGCGAAGATCGAGCAGAACGAGAAGCACCAG
AAGAATGTTAAGATAGTTGTAGACTTTCAAGCTTCTTGCAAGCGGATAACTAAACAGGCGCTTTCTCAGGGGAAAGATCC
TCGTCTCCAGTTAATCTCAACACCAAAATGTGGGCCTCGTGATAGCTCAGAGGATAATGATAAAAAGATATCTCCTTTGA
CGTTTGGTCCATCGGAAAACAGTTGTGTTGAAAACTATAGGATGGCAATAAAGAACTATCCAGTTTCAGTGAATCGCAGA
AGTTGGTCTACTGAGGAGAACGAAAATCTTGCAAAAGGTCTAAAACAACAACTTCAGGAAACACTGCTTAATGAAGCTAT
AGAACGTTACAGCGACTTGGAAGGATCTTCAGATGATATAGAGACCATTAATGAATCGATCAAAAATCTTGAGATCACAC
CAGAGATGATGCGGCAGTTTCTTCCGAAAGTGAATTGGGATCAGTTGGCCTCAATGTACGTCAAGGACCGTTCTGCTGCA
GAATGTGAAGCTCGGTGGATGAGCTCGGAAGATCCATTAATCAACCACGATCCGTGGACTGCGGAGGAGGAAAATAACCT
GCGGGTAATTATCCAAGAAAAGGGTTTTACAGACTGGCTTGACATTGCGGTGTCACTAGGGACAAATAGGACCCCCTTTC
AATGTTTGGCTCGATATCAGAGAAGCTTGAATGCAGACATATTAAGAAAAGAATGGACTGCAGAGGAAGATGACCAACTC
CGCGCAGCAGTGGAGTTGTATGGTGAAAAAGACTGGCAGACTGTCGCAAATGCATTAGAAGGACGGGCTGGAACTCAGTG
CTCTAATAGATGGAAAAAGACGCTCCATCCTACCAGAACGAGGGTAGGGAAATTTAGCTCAGACGAAGAAAAACGTTTGA
AAGTAGCTGTGACACTCTTTGGAGCTCAAAACTGGCATAAAATTGCTCGCTTTGTTCCTGGACGAACCTCTACTCAGTGT
CGAGAGAAATGGGCGAATTGTTTAGATCCCAATGTAAATCATGGGAAGTGGAGCAAGGAAGAAGATGCAAAGTTGAGAGA
AGCAATGGCAGAACATGAGATTGGTAATTGGTCAAAAATCGCTTCACATGTGCCTCGTCGTACTGATAATCAATGCCGGA
GGAGGTGGATGCAGCTATATCCACACCAAGTGCCTCTTTTACAAGAAGCTACAAGGTTACGCAAAGAAGCTATTGTAGGT
AACTTTGTTGATCGGGAGTCACAACGTCCTGCTCTTCTCGAATGCAAGTTTCTTGCACTACCTGAGATACCTCTTGAGCC
AGAACCCGAAATTGTAGCCGTGAAGAAGAAACGCAAAGCAAGACCGAAGAAAGCAGATGCAGAATGCGAGAGTGAAGTAT
CTTCTGCTGCTAAAGAGAGGCGGCCAAAGAGAAGGAGAAAAGGATTAGAGAGATGCTCAGGAGATGTATGTAGACAAGAG
AATGAGACTGTCTGTGAAAATATCGAGAATCTAGACAATGGAGGAGAGGTTAGGTCTTTGGAATGGTATAAAGAGAATCA
AGACAATGTAAAGGAGAAGAAACAAAGACGAAGACGCAAAAGTGTTGCAGAAACATCCAACAACAGCACAGTGACCACCG
ACTGCTCTCAAGTCAAAGTTGGTGTCAAGAAGCTTACGCCTAGAAGGAAAGTGTCTGCAGTAGTTCCTGTCGAGAACCAA
GATGCACCAAACTAG