Details for Chinese cabbage Locus Brara.E02380

Position : A05 ( 5`- 21458497 .. 21459705 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02380

Protein [Map View]
MAEGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLSSDGQFALS
GSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTISEADGHKDWISCVRFSPN
TLVPTIVSASWDKTVKVWNLQNCKLKSSLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEGGSIIHSL
CFSPNRYWLCAATESSIKIWDLESKTVVDELKVDLKAEAEKDGGAGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVRVW
GIGRY*

DNA
ATGGCCGAGGGACTCGTACTGAAAGGCACAATGCGCGCCCACACCGACATGGTCACCGCCATCGCCACGCCGATCGACAA
CTCCGACATCATCGTCACCTCCTCCCGCGACAAATCCATCATCCTCTGGAAGCTCACCAAGGACGACAAGTCCTACGGCG
TCGCCCAGCGTCGTCTCACAGGCCACTCCCACTTCGTCGAAGACGTGGTCCTCTCCTCCGACGGCCAGTTCGCTCTCTCC
GGAAGCTGGGACGGCGAGCTCCGTCTCTGGGACCTAGCCACCGGCGTCTCCACCCGCAGATTCGTGGGACACACGAAAGA
CGTCCTCTCCGTGGCCTTCTCCGTCGACAACCGTCAGATCGTGTCGGCCTCTCGTGACCGTACGATCAAGCTCTGGAACA
CGCTTGGTGAGTGTAAGTACACGATCTCTGAAGCCGATGGGCATAAGGATTGGATTAGCTGTGTTAGGTTTAGCCCCAAC
ACGCTTGTCCCCACCATTGTTTCGGCTTCGTGGGATAAGACTGTGAAAGTGTGGAATCTTCAGAACTGTAAGCTGAAGAG
CTCTCTCGCTGGGCACTCGGGTTACCTCAACACTGTGGCTGTGTCGCCTGATGGTTCGTTGTGTGCGAGTGGTGGGAAAG
ATGGTGTGATCTTGTTGTGGGATTTGGCTGAGGGGAAGAAGTTGTACTCGCTTGAGGGGGGTTCGATTATTCACTCGCTT
TGCTTTAGTCCGAATAGGTACTGGCTGTGTGCTGCGACTGAGAGCAGTATCAAGATCTGGGATCTTGAGAGTAAGACTGT
TGTTGATGAGTTGAAGGTTGACCTTAAGGCGGAGGCTGAGAAGGATGGTGGTGCCGGAACTGGTAACCAGAAGAAGGTGA
ACTACTGCACAAGCTTGAACTGGAGCGCAGATGGAAGCACACTGTTCAGTGGTTACACTGATGGAGTTGTCAGGGTCTGG
GGCATTGGTCGTTACTAG