Details for Chinese cabbage Locus Brara.E02378

Position : A05 ( 5`- 21456272 .. 21458262 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02378

Protein [Map View]
MSQPCVVLATASYDHTIRFWEAESGRCYRTIQYPDSHVNRLEITPDKRHLAAACNPHIRLFDVNSNSPQPVMTYDSHTNN
VMAVGFQCDGKWMYSGSEDGTVKIWDLRAPGCQREYESVAAVNTVVLHPNQTELISGDQNGNIRVWDLRANSCSCELVPE
VDTPVRSLTVMWDGTMVVAANNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTVKIWNV
DGFKLEKILTGHQRWVWDCVFSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHKATVCCALHD*

DNA
ATGAGTCAGCCATGTGTAGTTCTCGCAACAGCGAGCTACGATCACACGATCCGATTCTGGGAAGCCGAGAGCGGTCGGTG
TTACCGTACCATTCAGTATCCTGACTCGCATGTGAATAGGCTGGAGATAACCCCAGATAAGCGTCATCTGGCAGCAGCTT
GTAATCCTCATATACGTCTCTTTGATGTCAATTCCAACAGCCCTCAACCTGTGATGACTTATGATTCACACACCAACAAT
GTTATGGCAGTGGGGTTCCAGTGTGATGGGAAATGGATGTATTCTGGATCAGAGGATGGTACTGTTAAAATCTGGGACTT
GAGGGCTCCAGGTTGCCAAAGAGAGTATGAGAGTGTTGCCGCTGTTAACACTGTTGTTTTACACCCAAATCAGACTGAGT
TGATATCTGGAGACCAAAACGGCAATATACGTGTATGGGATCTCAGAGCAAATTCGTGTAGCTGTGAACTGGTACCAGAA
GTTGATACACCTGTACGCTCTCTAACGGTTATGTGGGATGGGACTATGGTTGTTGCTGCTAACAACCGTGGAACATGTTA
TGTTTGGCGCTTGTTGCGCGGAAAACAGACGATGACAGAGTTTGAGCCACTTCATAAGCTGCAAGCTCATAACGGCCACA
TCCTTAAATGCTTACTCTCTCCTGCAAACAAATATCTAGCGACTGCATCATCTGATAAAACTGTCAAAATATGGAACGTC
GATGGTTTCAAACTAGAGAAAATTTTAACAGGACACCAAAGATGGGTATGGGACTGCGTCTTCTCAGTGGATGGAGAGTT
TCTTGTAACAGCATCATCGGACATGACGGCTAGGTTGTGGTCTATGCCAGCGGGAAAAGAAGTCAAGGTGTACCAAGGTC
ATCACAAAGCCACCGTGTGTTGTGCCCTCCATGATTAA