Details for Chinese cabbage Locus Brara.E02377

Position : A05 ( 5`- 21413352 .. 21415289 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02377

Protein [Map View]
MATNNGDVLMLEAAPEATKPWASAANAEVIDALPYIDDDYGNPLIKAEVDRLVEEEMRRSSKKPADFLKDLPPLPKFDFE
NCPVLGKEYERVRAGKPPVRIDFESRYKHELPPAGKKNDDAAWKQYLHKTQRSLQQKMIELENLEMMSKQGPEIWRQNNH
RLEVFLTRMQRLAQEQNEEIEKVNRERKYHQQTTAYELNALSQEWRQLCVKNMEIQSACAVLETQIDLLKREASERGWNL
EEKLESVKPLQSQ*

DNA
ATGGCGACGAACAATGGAGACGTTTTGATGCTGGAGGCGGCGCCAGAAGCTACGAAACCCTGGGCGAGCGCGGCGAACGC
AGAAGTTATCGATGCGCTTCCTTATATAGACGATGACTACGGCAATCCACTGATTAAGGCTGAGGTGGACCGCTTAGTGG
AGGAAGAGATGCGTCGGAGCTCTAAGAAGCCTGCTGACTTCCTCAAGGATCTCCCTCCTCTTCCCAAGTTCGATTTCGAG
AACTGTCCAGTTCTAGGCAAAGAGTATGAGCGTGTTCGAGCCGGGAAGCCTCCAGTGCGGATCGATTTCGAGTCACGGTA
TAAGCATGAATTGCCGCCTGCTGGTAAGAAAAATGATGATGCTGCTTGGAAGCAGTATCTTCACAAGACTCAGCGGTCAT
TGCAACAGAAGATGATCGAGCTTGAGAATTTGGAAATGATGTCAAAACAAGGGCCCGAGATTTGGAGACAGAACAATCAT
CGGCTAGAAGTATTCTTGACCAGAATGCAAAGACTAGCTCAGGAGCAGAACGAGGAGATTGAAAAAGTTAATCGTGAGAG
GAAGTATCATCAGCAAACCACAGCGTACGAGCTAAACGCTCTATCTCAAGAATGGAGACAGCTCTGTGTCAAGAACATGG
AGATTCAGTCTGCGTGTGCTGTGCTTGAGACACAAATCGATTTGTTGAAAAGGGAAGCTTCTGAAAGGGGATGGAACTTA
GAAGAGAAACTAGAGAGTGTCAAACCGCTTCAATCGCAGTGA