Details for Chinese cabbage Locus Brara.E02371

Position : A05 ( 5`- 21375098 .. 21376563 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02371

Protein [Map View]
MWKEESLDLVLVPAGLAVMATYHVWLGYTIIHRPKLTAISLNAESRRLWVFAMMDDPMKNGVLAVQTIRNNIMASTVLAT
TAITLCSIIGLFVSSTSASESTASPVIYGNRSPLLATTKNFSILICFLMAFLCNVQSIRYYAHVSFLVTVPVSRGEKEHC
EYVARNLNRALYFWFLGLRAFYFSFPLFLWNFGPIPMFVCCCMMSSILYFLDTTTSFTRRLHSQSFRETAESMDGEIESV
VHAL*

DNA
ATGTGGAAGGAGGAATCGCTGGATTTAGTACTAGTGCCGGCGGGTCTCGCCGTCATGGCCACTTACCATGTCTGGCTCGG
CTACACCATTATCCACCGTCCGAAGCTCACCGCTATCTCCCTCAACGCTGAGTCTCGACGACTATGGGTCTTCGCTATGA
TGGACGATCCGATGAAAAACGGTGTATTGGCAGTACAGACAATCAGGAACAACATAATGGCATCAACCGTTTTAGCCACA
ACAGCAATCACTCTCTGTTCCATCATCGGCCTCTTCGTAAGCAGCACCTCCGCTTCGGAATCCACAGCGTCGCCTGTGAT
ATACGGCAACAGAAGCCCTCTCCTTGCAACCACCAAGAACTTCTCGATCCTCATCTGTTTCCTCATGGCCTTTCTCTGCA
ACGTCCAGTCCATCAGGTACTACGCTCACGTTAGTTTCCTAGTCACTGTGCCCGTCTCCAGAGGGGAAAAAGAGCACTGC
GAGTACGTGGCTAGGAACCTGAACCGAGCTCTCTACTTCTGGTTTCTCGGGTTGCGGGCTTTCTACTTCTCCTTCCCTCT
CTTTCTTTGGAACTTTGGTCCCATCCCCATGTTTGTGTGCTGTTGTATGATGTCTTCGATTTTGTATTTCTTGGACACGA
CCACTTCTTTTACTAGGCGTCTTCATAGCCAGTCGTTTAGAGAAACTGCTGAGTCGATGGACGGTGAAATCGAATCAGTG
GTTCATGCTCTCTAG