Details for Chinese cabbage Locus Brara.E02368

Position : A05 ( 5`- 21363594 .. 21365948 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02368

Protein [Map View]
MRGALFRNASLCARRLLLSPRITTPQPSSSSSNAPFLAPIVTPFSPRLFSSESDSSGENPPPPESSSPIEPSNKKDLAVE
DVGNKELKARIEKYFNEGNEDALPGIIEALLQRRLVDKHADTDDEVMDALQNQPFKDDVKDEDFESDFEEAHSTDDELED
LYNSPEYVKKKMQNNEFFNMDEKKWDVIVRDGIRHGILKDTKECEEILEDMLHWDKLLPDDLKKKVEAKFNELGDMCERG
EIEPEAAYELFKEFEDEMVIQYGDQMEAAGPPKFDETDPSYSNTNLDDPPGEGPILRWQSRIVFAPGGDAWHPKNRKVKL
SVTVKELGLSKHQARRLRELVGKRYDSGKDELTITSERFEHREENRKDCLRTLYGLIEEAAKANKIAEDIRTAYVKQRLQ
ANPAFMQKLQAKIMRSKESNPINA*

DNA
ATGAGAGGAGCTCTCTTCAGAAACGCCTCTCTCTGCGCTCGCAGACTTCTCCTTTCTCCTCGTATCACCACTCCTCAACC
CTCCTCCTCCTCCTCCAATGCTCCCTTCCTCGCTCCGATCGTCACTCCGTTTTCCCCCAGATTATTCTCCTCCGAATCCG
ACTCCTCCGGCGAGAACCCACCTCCTCCGGAGTCTTCTTCTCCGATTGAACCCTCCAACAAGAAAGATCTCGCTGTAGAA
GACGTAGGCAACAAAGAGCTTAAGGCCCGTATAGAGAAGTACTTCAACGAAGGAAACGAAGACGCTTTGCCCGGAATCAT
CGAAGCTCTTCTCCAGAGAAGGCTTGTTGACAAGCACGCGGACACTGATGACGAAGTGATGGACGCTCTCCAGAACCAGC
CTTTCAAAGACGATGTGAAAGATGAAGACTTTGAATCTGATTTCGAGGAAGCTCACTCTACTGACGACGAGCTCGAGGAT
CTGTATAATTCCCCTGAGTATGTGAAGAAGAAGATGCAGAACAATGAGTTCTTTAACATGGACGAGAAGAAGTGGGATGT
TATTGTTAGAGATGGGATAAGGCATGGGATTTTGAAAGATACTAAGGAGTGTGAAGAGATTCTTGAGGATATGCTTCACT
GGGACAAGCTTCTTCCTGATGACTTGAAGAAGAAAGTTGAAGCAAAGTTTAATGAGCTCGGTGACATGTGTGAAAGGGGT
GAAATCGAGCCAGAAGCAGCTTATGAGCTGTTTAAGGAATTCGAAGATGAGATGGTGATTCAATATGGGGATCAAATGGA
AGCTGCGGGACCTCCCAAGTTTGATGAAACGGATCCTTCCTACAGCAACACTAACTTGGATGACCCTCCTGGTGAAGGCC
CAATCCTTAGGTGGCAGTCAAGGATTGTTTTTGCTCCTGGAGGCGATGCTTGGCATCCAAAGAACAGGAAAGTTAAACTG
TCTGTTACAGTGAAAGAGCTCGGACTCTCAAAGCATCAGGCTCGTAGGCTAAGGGAGCTCGTGGGGAAAAGATATGATTC
AGGGAAAGACGAGCTTACAATCACCAGCGAGAGGTTTGAACATCGAGAAGAAAACAGGAAAGACTGTCTGAGGACGCTTT
ACGGGTTGATAGAGGAAGCTGCGAAAGCTAACAAGATCGCCGAGGACATAAGAACTGCTTATGTGAAACAGAGGCTCCAA
GCTAATCCAGCTTTTATGCAGAAACTACAAGCCAAGATCATGAGGTCTAAAGAATCAAATCCCATCAACGCATAG