Details for Chinese cabbage Locus Brara.E02366

Position : A05 ( 5`- 21355735 .. 21355959 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02366

Protein [Map View]
MARHLGNVITMATTTTQFHVSYLLHVVFLALFSCCVLSALLLSCADGASSDSDLAYSGNIPDAGGAGCGGGCGD*

DNA
ATGGCGAGACATTTAGGAAATGTAATTACCATGGCGACAACAACAACACAGTTCCATGTTAGTTACCTTCTTCATGTTGT
GTTCTTGGCTCTGTTCAGCTGTTGTGTCCTCTCGGCTCTGTTACTCTCATGTGCAGATGGAGCCTCCAGCGACAGCGACC
TAGCGTATTCCGGCAACATCCCTGATGCCGGAGGTGCTGGCTGCGGTGGTGGCTGTGGAGATTAA