Details for Chinese cabbage Locus Brara.E02364

Position : A05 ( 5`- 21337902 .. 21338192 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02364

Protein [Map View]
MVMIKATWVSIFAIAAVLLVILAPAAEAVTCSPMQLSPCAQAITSSSPPSALCCAKLKEQKPCLCGYMRNPSLRRFVSSP
NARKVSNRCKLPIPRC*

DNA
ATGGTGATGATCAAGGCTACATGGGTTTCCATCTTCGCCATCGCGGCGGTTCTCCTAGTGATTCTAGCCCCGGCGGCAGA
AGCAGTGACGTGCTCGCCAATGCAGCTAAGCCCATGCGCGCAGGCGATAACGTCGTCTTCTCCACCGTCAGCGTTGTGCT
GCGCGAAGCTGAAGGAACAGAAGCCATGCCTATGTGGGTACATGAGAAACCCTAGCCTCCGTCGCTTCGTCAGCTCTCCC
AACGCTCGTAAAGTCTCTAACCGCTGCAAGCTCCCCATCCCAAGGTGTTGA