Details for Chinese cabbage Locus Brara.E02359

Position : A05 ( 5`- 21308883 .. 21309638 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02359

Protein [Map View]
MIFAESSHQRISFAGDLGQSDKALTIEQQQQPSGVVRRDTTLLDSEFEFHTSRSFDSSPADEIFADGMILPFQATSSMPK
RRYKYELPPIVSSIPPPPPPPPLPSPQQSRKYCQKETPVAETSSKSFWSFSRSSSLNCDIKKSLICSFPRLTRSISTGSV
MNSKRAMLRDVDKHSSLRHGGAPRPQADPSSCPPSSCCSSYQFRPHKQSGKNSCSSRGGSFRITPVIGGPSPSGLGSILR
LSKDKKTKNTK*

DNA
ATGATCTTTGCGGAGTCAAGTCACCAGCGGATATCGTTCGCGGGCGATCTCGGCCAATCAGATAAAGCACTTACAATTGA
ACAACAACAACAGCCATCAGGAGTGGTTAGAAGAGACACAACACTTTTAGATTCAGAATTCGAGTTCCACACTTCAAGAA
GCTTTGATTCCTCACCAGCTGATGAGATCTTCGCTGATGGGATGATCCTTCCTTTCCAAGCAACATCCTCCATGCCAAAA
CGTCGTTACAAGTACGAGCTCCCTCCTATCGTCTCCTCTATTCCTCCTCCTCCTCCTCCTCCGCCATTGCCATCACCGCA
ACAGTCCAGAAAATACTGTCAGAAGGAGACTCCCGTGGCGGAGACATCATCAAAGTCGTTTTGGAGCTTCAGTAGAAGCT
CGAGCCTTAACTGCGATATAAAGAAGAGTTTGATATGTTCCTTTCCTCGTTTGACAAGAAGCATTTCCACAGGATCAGTG
ATGAATTCGAAGAGGGCAATGCTTAGGGACGTTGACAAGCATAGCTCGCTGAGACATGGAGGAGCCCCACGTCCACAAGC
GGATCCTTCATCTTGTCCTCCCTCTTCCTGCTGCAGCTCGTATCAGTTCAGGCCACATAAGCAATCCGGAAAGAACAGCT
GCAGCAGCAGAGGAGGAAGCTTTCGGATTACTCCAGTGATAGGTGGTCCATCTCCGTCTGGATTAGGATCTATCTTACGA
CTTTCGAAAGATAAGAAGACCAAGAACACTAAGTAG