Details for Chinese cabbage Locus Brara.E02356

Position : A05 ( 5`- 21277222 .. 21279613 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02356

Protein [Map View]
MGRPPSNGSPAFRFNMAEVMEMEGILLQHNVAMPSRHILEDLADKFSESAERKGKIVVQFKQIWNWFQNRRYALRARGNK
APGKLNVSSSMPPGVDSTNQMRNVLSVPGVMRSDSYKSYLEFEAKSARDGAWYDVHNFLAHRNLETGDPEVQVRFAGFEV
GEDEWIKVKKHIRLRSHPCEASECVAVLAGDLVLCFQEGKDQALYFDAKVLDAQRRRHDIRGCRCRFLVRYSHDQSEEIV
PLRKICRRPETDYRLQQLHSSANDFANSNHLQKPAPDAAAAPQSSASVPIVVPEKKDPSLISASATSVQPGSNAATVPAG
SV*

DNA
ATGGGTCGGCCTCCAAGTAATGGCAGTCCGGCTTTCCGGTTTAACATGGCTGAGGTAATGGAGATGGAGGGAATATTGTT
ACAGCATAATGTAGCAATGCCAAGTCGGCATATTCTTGAAGATCTTGCTGACAAGTTTAGTGAATCAGCGGAGCGGAAGG
GGAAGATTGTTGTGCAGTTCAAACAAATATGGAACTGGTTCCAAAACAGGAGATATGCTCTAAGAGCAAGGGGGAATAAA
GCTCCTGGGAAGCTTAATGTGTCTTCTTCCATGCCGCCCGGTGTGGATTCAACAAATCAGATGAGAAATGTGCTTTCAGT
TCCCGGTGTCATGAGGAGTGATTCGTACAAATCTTACTTGGAATTTGAAGCCAAATCTGCCAGGGACGGTGCATGGTATG
ATGTGCATAATTTTCTAGCTCATAGAAACTTGGAGACTGGTGATCCGGAAGTGCAGGTTCGATTTGCGGGTTTTGAAGTT
GGAGAAGATGAATGGATAAAAGTCAAGAAGCACATAAGGCTACGATCACACCCATGTGAAGCATCAGAATGTGTTGCAGT
TCTTGCTGGAGATCTCGTTCTTTGCTTCCAGGAAGGTAAAGATCAAGCTCTCTATTTTGACGCCAAAGTTCTTGATGCAC
AAAGAAGAAGACACGATATCAGAGGTTGTCGTTGTAGGTTCTTGGTGCGTTACAGCCACGACCAGTCCGAGGAAATCGTT
CCCTTGAGGAAGATTTGCCGGCGGCCTGAGACAGATTACAGGCTACAGCAACTTCACAGTTCTGCCAATGACTTTGCTAA
CTCGAATCACCTCCAGAAACCCGCTCCGGACGCGGCTGCAGCTCCACAATCCAGCGCATCAGTTCCCATTGTTGTACCCG
AGAAGAAAGATCCGAGTTTGATCTCCGCTTCAGCCACTTCAGTTCAACCTGGCTCCAATGCAGCCACTGTCCCCGCTGGT
TCTGTGTAG