Details for Chinese cabbage Locus Brara.E02352

Position : A05 ( 5`- 21262161 .. 21263524 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02352

Protein [Map View]
MGRKKGLPEFEETAPDGFDPENPYKDPVAMVEMREHIVREKWIQIEKAKILREKVKWCYRVEGVNHYQKCRILVQQYLDS
TRGVGWGKDHRPISLHGPKPEAVEAE*

DNA
ATGGGGAGAAAGAAGGGATTGCCGGAGTTCGAAGAGACGGCGCCGGATGGATTTGATCCGGAGAATCCGTACAAGGATCC
GGTGGCGATGGTGGAAATGAGAGAGCACATCGTTAGGGAGAAGTGGATCCAAATCGAGAAGGCTAAGATCTTGAGGGAGA
AGGTGAAATGGTGTTACCGCGTGGAAGGAGTCAACCATTACCAGAAATGCCGTATTCTCGTACAGCAGTATCTCGACTCC
ACTCGCGGCGTCGGCTGGGGAAAAGATCACCGTCCTATCTCCCTCCACGGTCCTAAGCCTGAGGCTGTTGAAGCTGAATA
A