Details for Chinese cabbage Locus Brara.E02348

Position : A05 ( 5`- 21228578 .. 21233258 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02348

Protein [Map View]
MEAVQDGSERDKTTPSSSSSSSSPIPVVTSFWKEFDLEKEKSILDEQGLRIAENQENSQKNRRKLAESTRDFKKASPEDK
LGMFNSLLKGYQEEVDNITKRAKFGENAFLNIYQKLYEAPDPFPALASIAEQERKLSEVESENRKMKVELEEYRTEATHL
KNQQSTIRRLEERNRQLEQQMEEKIKEVVEIKQRNLAEENQKTLELLKDRRLKEKIGFLTDELEKTKADNVKLYGKIRYV
QDYNHDKVVSRGSKKYVEDLESGFSSDVESKYKKIYEDDINPFAAFSKKEREQRVKDLGIRDRITLSSGRFLLGNKYART
FAFFYTIGLHVLVFTCLYRMSALSYLSHGAEETPVTETTTNLPRGF*

DNA
ATGGAGGCCGTGCAAGATGGATCGGAGAGAGATAAAACTACTCCTTCTTCTTCTTCTTCATCATCCTCTCCCATTCCTGT
CGTCACCAGTTTTTGGAAAGAATTTGATTTGGAGAAGGAGAAGAGTATACTTGACGAGCAAGGGCTTAGGATAGCTGAGA
ATCAAGAAAACAGCCAGAAGAATCGGCGAAAGCTTGCAGAGAGCACCAGGGACTTCAAAAAAGCATCGCCTGAGGACAAA
CTTGGTATGTTTAACTCCTTGCTCAAGGGGTATCAGGAAGAAGTTGATAATATTACCAAGAGGGCCAAGTTTGGGGAGAA
TGCTTTCTTAAACATCTATCAGAAACTCTATGAAGCACCAGATCCCTTTCCTGCTCTTGCGTCTATTGCTGAGCAAGAGC
GTAAATTATCTGAAGTGGAATCTGAGAATCGAAAAATGAAAGTTGAACTTGAGGAATATAGGACAGAAGCGACTCATCTG
AAAAATCAACAGTCCACAATAAGGAGACTAGAAGAACGGAACCGCCAGCTTGAGCAGCAGATGGAAGAAAAAATCAAGGA
GGTTGTTGAGATCAAGCAAAGAAATCTGGCTGAGGAAAATCAGAAAACGCTGGAGCTTTTAAAGGATAGGCGATTAAAAG
AGAAGATAGGCTTTCTCACAGACGAATTGGAGAAGACCAAAGCAGACAACGTCAAACTCTATGGTAAAATCCGTTATGTC
CAAGACTATAACCATGATAAAGTTGTTTCCCGGGGATCAAAGAAGTATGTGGAAGATCTGGAAAGTGGATTTAGCTCGGA
TGTGGAATCTAAATACAAGAAAATATACGAGGATGATATCAACCCATTTGCAGCATTCTCGAAAAAGGAAAGAGAGCAAC
GGGTCAAAGATTTGGGAATTAGAGATCGGATTACATTAAGCAGTGGGCGTTTTCTTCTAGGAAACAAGTATGCGAGGACA
TTTGCATTCTTCTACACAATAGGATTGCATGTACTGGTCTTCACTTGCCTCTATCGTATGTCTGCTCTCAGCTATCTCAG
CCATGGAGCTGAGGAGACTCCGGTGACAGAAACAACCACAAACCTCCCTCGCGGTTTTTAA