Details for Chinese cabbage Locus Brara.E02347

Position : A05 ( 5`- 21216038 .. 21217745 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02347

Protein [Map View]
MASARFLSLLSTVTLSLLLTTTDASSRSLPTSHETTVLDVVSSLQQTQHILSIDPTRSSLTTTTSAPESVPVFLNSSSPL
SLELHSRDTLVASQHKDYKSLVLSRLERDSSRVAAIIAKVNLAVEGADSETRYQPEELTTPVISGASQGSGEYFSRLGVG
TPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYKSLTCSAPQCASLRASACRSDKCLYQVRYGDGSFTVG
EYATDTVTFGSSGKVDNVALGCGRDNEGLFTGAAGLLGLGGGALSMTSQIKAKSFSYCLVDRDSGKSSSLDFNSVQVGAG
DATAPILRNSKIDTFYYVGFTGFSVGGQQVSIPSSAFAVDASGTGGVILDCGTAVTRLQTQAYNSLRDAFVKLTANLKRG
TSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNYLIPIDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLG
NHLIGLSANKC*

DNA
ATGGCTTCCGCAAGATTTTTATCTCTCCTCTCCACCGTCACTCTCTCTCTTCTCCTCACCACGACCGATGCTTCCTCTCG
CTCCCTACCAACATCACACGAAACGACCGTACTCGACGTCGTTTCATCTCTCCAGCAAACACAACACATCCTCTCAATCG
ACCCGACTCGCTCCTCACTCACCACCACCACCAGCGCACCCGAATCCGTCCCGGTCTTCCTCAACTCCTCCTCTCCACTC
TCTCTAGAGCTCCACTCCCGAGACACCCTCGTCGCGTCACAGCACAAGGACTACAAGAGCCTAGTACTGAGTCGACTCGA
GCGAGACTCATCCCGAGTCGCCGCAATCATCGCTAAAGTCAACCTCGCCGTCGAGGGCGCCGACAGCGAGACCCGATACC
AACCCGAGGAGCTAACGACACCTGTCATCTCCGGAGCTAGCCAAGGAAGCGGCGAGTACTTCTCCCGGCTCGGCGTCGGA
ACTCCGGCGAAGGAGATGTACATGGTGCTCGACACCGGAAGCGACATCAACTGGATCCAGTGCAAGCCTTGCTCCTCCTG
CTACCAACAATCCGACCCGATATTCGACCCGAGTTCATCCTCCACGTACAAGTCCCTCACTTGCTCCGCTCCACAGTGCG
CTTCTCTAAGAGCCTCTGCTTGCCGCTCAGACAAGTGTCTCTACCAAGTTCGTTACGGCGACGGGTCTTTCACCGTCGGT
GAATACGCAACCGATACGGTGACGTTTGGAAGCTCAGGTAAAGTAGACAACGTTGCTTTGGGGTGTGGTCGTGATAACGA
GGGACTCTTCACCGGAGCAGCCGGTTTACTCGGTTTAGGCGGTGGGGCTTTGTCGATGACAAGTCAGATCAAAGCGAAGT
CTTTCTCTTACTGCCTCGTGGACCGCGACTCGGGGAAGTCGTCGAGTCTCGACTTCAACTCGGTGCAAGTCGGCGCCGGA
GACGCGACGGCGCCGATCCTCCGTAACAGCAAGATCGACACTTTCTACTACGTCGGGTTCACTGGATTCAGCGTCGGCGG
TCAGCAAGTCTCCATCCCTTCGTCGGCGTTCGCCGTCGACGCTTCGGGAACCGGAGGAGTGATCTTGGACTGTGGAACCG
CCGTGACTCGGCTCCAGACTCAGGCCTATAACTCGCTCCGCGACGCGTTTGTTAAACTCACGGCGAATCTCAAAAGAGGA
ACGTCGAGCATCTCTTTGTTCGACACGTGCTACGACTTCTCGTCTCTCTCCACCGTGAAAGTCCCGACGGTGGCGTTTCA
CTTCACCGGTGGGAAGACGCTTAATTTGCCGGCGAAGAATTACTTGATACCTATTGATGATGCGGGGACGTTCTGCTTCG
CTTTTGCTCCGACGTCGTCTTCGTTGTCGATCATCGGGAACGTGCAGCAGCAAGGGACACGTATCACTTACGATCTAGGG
AATCATCTTATCGGGTTGTCAGCTAATAAATGCTAA