Details for Chinese cabbage Locus Brara.E02345

Position : A05 ( 5`- 21207508 .. 21208162 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02345

Protein [Map View]
MALSSMTWAYARIIAGTLLGGTLGFYVMHRVEVSYKMKMEEALRQYEKDMKKRQEEENLGHISEDSG*

DNA
ATGGCGCTGAGCTCGATGACATGGGCTTACGCACGGATCATAGCTGGAACACTTCTCGGTGGGACTCTCGGATTCTACGT
AATGCACCGCGTCGAAGTTAGCTACAAGATGAAGATGGAGGAAGCGTTAAGGCAATACGAGAAGGACATGAAGAAAAGAC
AAGAAGAAGAGAATCTCGGTCACATCAGCGAAGATTCGGGTTAG