Details for Chinese cabbage Locus Brara.E02344

Position : A05 ( 5`- 21178865 .. 21179008 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02344

Protein [Map View]
MREEAVKNLEKKKKSCSPRGVGKFLNKKKGKFYIIGKCITMLLCAHE*

DNA
ATGAGGGAGGAGGCAGTGAAGAATTTGGAAAAGAAAAAGAAGTCTTGTTCACCGAGAGGAGTTGGGAAGTTTCTGAACAA
GAAGAAAGGAAAGTTCTACATCATTGGGAAATGTATTACTATGCTTCTTTGTGCACACGAGTGA