Details for Chinese cabbage Locus Brara.E02340

Position : A05 ( 5`- 21136515 .. 21136989 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02340

Protein [Map View]
MEISRREHVSSVHQCLSASRISKKLKLKERPKELLTTLSKKAKSIAGRKKKAYDGCGGTKAKTAVEMVMEEEEEEEYGIW
QRKILMGDKCEPLCYSGVIFYDCRGHQVKELPPRSPCSIWVPEQPRRSYVGSVLSSTEEEFD*

DNA
ATGGAGATATCGAGGAGGGAACATGTTTCATCAGTCCACCAGTGTCTAAGCGCCAGCCGAATCTCCAAGAAGCTTAAACT
CAAAGAACGTCCTAAGGAGCTTTTGACGACTTTAAGCAAAAAGGCGAAGAGTATTGCTGGCCGGAAGAAAAAAGCTTACG
ACGGCTGTGGTGGTACAAAAGCAAAGACGGCGGTGGAAATGGTGATGGAGGAGGAAGAGGAGGAGGAATATGGCATTTGG
CAGAGAAAGATTTTAATGGGAGACAAATGTGAGCCGTTGTGTTATTCCGGCGTGATCTTCTACGATTGTCGTGGACATCA
AGTAAAGGAACTGCCTCCGAGATCGCCATGTTCCATTTGGGTGCCGGAACAGCCGAGACGTTCGTATGTCGGGTCGGTAT
TAAGCTCGACGGAAGAGGAATTTGACTGA