Details for Chinese cabbage Locus Brara.E02339

Position : A05 ( 5`- 21133702 .. 21134199 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02339

Protein [Map View]
MAETFSSGDAQYWPIYGSSNTTERNSPYASLIRLLRSHSPTSSQLFGLLALFISGGILLFLLGVTVTAVGIGFVVFLPLI
IISSPVWIPVFIGVGGFLSVAGFLVGTLAVVSWAYRYFRGRHPVGSDQMDYARGRIYDTASHVKDYAREYGGYFHGRAKD
AAPGA*

DNA
ATGGCGGAAACGTTCTCTAGCGGCGATGCACAGTATTGGCCCATCTACGGTAGCAGCAACACCACCGAAAGAAACAGCCC
TTACGCTTCTCTTATCCGCCTTCTCCGATCTCATTCACCAACCTCCTCACAGCTCTTTGGTCTCCTCGCTCTCTTCATAT
CCGGCGGAATCCTCCTCTTCCTCCTAGGCGTAACCGTGACGGCCGTCGGGATAGGCTTCGTTGTCTTTCTTCCGCTGATC
ATCATCTCGAGTCCGGTATGGATCCCGGTATTTATCGGGGTTGGCGGGTTCTTATCGGTGGCCGGTTTTCTTGTTGGAAC
GTTGGCTGTCGTATCGTGGGCGTATCGTTATTTCCGTGGAAGGCACCCGGTTGGATCGGATCAAATGGATTATGCACGTG
GTCGGATCTATGACACGGCCTCTCACGTCAAAGATTATGCTAGAGAGTACGGTGGGTATTTCCACGGTAGGGCTAAAGAT
GCAGCACCTGGTGCTTAA