Details for Chinese cabbage Locus Brara.E02333

Position : A05 ( 5`- 21104071 .. 21106612 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02333

Protein [Map View]
MEESSQGSFVTTINEDYESICWGCGLNLVLPSYAPVFKCGWCGAITNHNPVRPETRSFGLRRIRDRCFVVILAVFMLFVI
CGGIWAAYPVVFSISLACGILHSVTAVSLAISTLTTFMVVAFKCAGKPIDIVYGTHPGVGNGALNNYTFCHTCSKPKSPR
THHCRTCGMCVLDMDHHCPFIGNCVGAGNHKNFVAFLISAIISTIYASVMCVYSLIHILPSLENGAAYASSHASNSVSIL
RGVKSIVLAYLSNAVFISVRGLVLLYLFVASVSVAIGLSVLLWQQLSYIYEGKTYLNHLSSQGSEEDGEKSFGNLLTFFG
CPLLIERHLPTIRNLRKRHKT*

DNA
ATGGAAGAGTCTTCCCAGGGGAGTTTTGTTACAACCATAAACGAAGATTATGAATCAATCTGCTGGGGCTGTGGACTGAA
CCTTGTTCTTCCATCATACGCACCTGTTTTCAAGTGTGGCTGGTGTGGTGCAATCACGAATCATAATCCTGTCAGACCTG
AAACCAGAAGCTTTGGGCTGAGACGTATCCGCGACCGATGTTTCGTCGTGATTCTTGCTGTTTTCATGCTCTTTGTCATA
TGTGGTGGGATTTGGGCAGCTTATCCGGTCGTGTTTTCGATCAGCTTGGCTTGCGGGATTCTCCATTCTGTTACAGCAGT
GTCTCTGGCGATATCAACGTTAACAACATTCATGGTTGTTGCTTTTAAATGCGCGGGGAAACCAATTGATATTGTTTATG
GAACCCACCCTGGTGTAGGGAACGGCGCACTCAACAACTATACCTTTTGTCACACCTGCTCCAAACCAAAGTCACCTAGA
ACCCATCACTGTCGCACGTGTGGCATGTGCGTCCTCGACATGGATCATCATTGCCCCTTTATTGGTAACTGTGTTGGTGC
GGGCAATCACAAAAACTTCGTCGCCTTCCTTATCTCGGCCATTATAAGCACAATCTACGCTTCTGTTATGTGTGTGTATT
CCCTGATTCATATCTTGCCATCCCTAGAAAATGGAGCAGCGTATGCATCGTCACATGCTAGTAATAGTGTATCGATTCTG
AGAGGAGTGAAGAGTATCGTGCTTGCTTACTTATCCAACGCTGTCTTCATCTCTGTACGAGGCCTTGTTCTATTATACCT
CTTTGTGGCGAGTGTCTCCGTGGCCATTGGTTTAAGTGTTTTGCTATGGCAGCAGCTTAGCTATATCTATGAAGGAAAGA
CTTACTTGAACCATTTGAGTTCTCAAGGAAGCGAGGAAGATGGTGAAAAGAGCTTTGGGAATCTTTTGACGTTTTTTGGA
TGTCCACTTTTGATTGAGAGGCACTTGCCAACTATAAGGAACTTGAGGAAGAGACATAAGACATGA