Details for Chinese cabbage Locus Brara.E02332

Position : A05 ( 5`- 21102577 .. 21104466 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02332

Protein [Map View]
MASSTSKTLMDYFKPPKRHKASSFPAVSAAGGARGLDSAAKSPPRVTVADDSSGLTPDQISRSELNKSVARSKRNLALCS
EKVTKAKAEGSCYVELTELLVEESWLKALPGELDKPYAKTLSCFLEREIIIDGQAPPIYPPQHLVFNALNTTPFDRVKAV
IIGQDPYHGPGQAMGLSFSVPEGEKLPSSLLNIFKELQKDVGCSIPRHGNLQKWALQGVLLLNAVLTVRSKQPNSHAKKG
WEQFTDAVIRSISQQKQGVVFLLWGKYAQEKSKLIDGSKHHILTAAHPSGLSAHRGFFNCRHFSRANQLLEQMGTPPIDW
QL*

DNA
ATGGCTTCGTCAACATCTAAAACCCTAATGGATTATTTCAAACCTCCCAAACGCCACAAAGCTTCTTCCTTTCCCGCCGT
TTCCGCCGCCGGTGGGGCCCGCGGTTTGGATTCTGCAGCCAAATCGCCACCTCGCGTAACCGTTGCCGACGACTCGTCTG
GCCTTACACCAGACCAAATCTCTCGCTCAGAGCTCAACAAATCCGTCGCCAGATCCAAGCGCAACCTCGCCCTCTGCTCG
GAGAAGGTCACAAAAGCGAAAGCTGAAGGAAGCTGCTATGTTGAATTGACCGAGCTCTTAGTTGAAGAATCATGGCTTAA
AGCTCTCCCTGGAGAATTGGATAAGCCTTACGCCAAGACCCTTTCTTGTTTCCTTGAACGTGAGATCATCATTGACGGTC
AAGCCCCTCCTATTTACCCGCCGCAGCATTTGGTTTTCAATGCTCTAAATACAACTCCTTTTGATCGAGTCAAGGCTGTC
ATTATCGGACAGGATCCTTACCATGGACCTGGTCAAGCTATGGGTTTGTCCTTCTCTGTCCCTGAAGGAGAGAAGCTTCC
TTCTAGTCTTTTGAATATATTCAAGGAGCTTCAGAAAGATGTTGGCTGTTCTATCCCTCGTCATGGTAATCTACAGAAAT
GGGCTCTGCAGGGTGTTTTGCTGTTGAATGCTGTTCTTACAGTAAGGAGTAAACAGCCGAATTCACATGCAAAAAAAGGA
TGGGAACAATTCACTGATGCTGTCATTCGAAGTATCTCGCAGCAGAAGCAAGGTGTTGTCTTTCTCCTCTGGGGAAAATA
CGCTCAAGAGAAATCCAAGTTGATAGATGGGAGTAAACATCACATTCTCACAGCAGCTCATCCATCTGGTTTGTCAGCGC
ATAGAGGCTTCTTCAATTGCAGGCATTTCTCTCGAGCGAACCAGCTACTTGAGCAAATGGGCACTCCCCCTATAGACTGG
CAACTCTAA