Details for Chinese cabbage Locus Brara.E02330

Position : A05 ( 5`- 21095698 .. 21099270 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02330

Protein [Map View]
MANPPAAAVATSATGDPRRRLSASIEAICKRRFRRNSKSGGRSDMVKPFNILNFPTQDKNSSCCCSVFQIVKVLLCILLS
ATLFTIIYSPEAYHHSLSHSSIWIWRRQDPRYVSDLEISWDDVTKTIASVQEGRTIGVLNFDTKEIRRWRDVAMTKDNED
DENVVELDLEHAEKNVTWDALYPEWIDEEQEKDVPVCPNLPKIKVPTRRLDLVVVKLPCRNEGNWSRDVARLHLQMAAAT
VAASAKGFFGGHVMFVSRCFPMPNLFRCKDLVSRRGDVWLYKPNLDTLRDKLQLPIGSCELSLPFGIKERPSLGNPKREA
YATILHSAHVYVCGAIAAAQSIRQSGSTRDLVIVVDENISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWNYSKFRL
WQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESYNGGDQGYLNEVF
TWWHRIPKHMNFLKHFWVGDEDDVKRKKTELFGAEPPILYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRRWWMV
HDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHWKIRVKDKRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTP
PAITAVRKTSLPGHNL*

DNA
ATGGCAAACCCTCCCGCCGCTGCCGTTGCAACCTCTGCAACCGGAGACCCTCGGCGTCGCCTCTCAGCTTCCATTGAAGC
AATATGCAAGAGAAGGTTCCGGAGAAACAGCAAAAGCGGTGGCAGATCGGATATGGTGAAACCTTTTAATATCCTCAATT
TTCCGACACAAGACAAAAACAGTAGTTGTTGTTGCAGCGTGTTTCAGATCGTGAAGGTTCTCTTGTGTATCCTTTTATCG
GCTACTCTCTTCACCATCATCTATTCCCCTGAAGCTTATCATCATTCCCTTTCCCACTCTTCTATATGGATATGGAGAAG
ACAAGATCCAAGATATGTCTCGGACCTGGAGATAAGTTGGGACGATGTGACCAAAACCATTGCAAGCGTTCAAGAAGGCC
GTACGATTGGTGTCTTAAATTTCGATACGAAAGAGATCCGACGGTGGAGAGATGTAGCCATGACTAAAGACAACGAGGAT
GATGAAAACGTTGTTGAATTAGATTTGGAGCACGCAGAAAAGAACGTGACTTGGGACGCACTCTACCCAGAGTGGATCGA
TGAGGAGCAAGAAAAAGATGTCCCTGTTTGTCCTAACCTCCCAAAGATCAAAGTGCCTACAAGAAGACTAGATCTGGTCG
TTGTGAAGCTTCCTTGTCGGAACGAAGGAAACTGGTCAAGAGACGTCGCGAGATTGCATCTGCAGATGGCGGCAGCAACG
GTGGCAGCTTCGGCGAAAGGGTTCTTCGGAGGTCACGTGATGTTTGTCTCGAGATGTTTCCCGATGCCGAATCTATTTCG
GTGTAAGGATCTCGTGTCTAGGAGAGGCGATGTTTGGTTGTATAAACCTAATCTTGATACCTTGAGAGACAAGCTTCAGC
TTCCTATTGGTTCTTGTGAGCTCTCTCTTCCTTTCGGAATCAAAGAGAGACCAAGCTTAGGAAACCCTAAAAGAGAAGCT
TACGCAACAATTCTTCATTCTGCTCACGTTTACGTCTGCGGAGCAATCGCGGCCGCACAGAGCATAAGACAGTCAGGCTC
AACGAGAGACCTCGTGATCGTCGTCGATGAAAACATCAGCGGTTATCACAGGAGCGGACTCGAAGCTGCTGGTTGGCAAA
TCAGGACAATACAGCGGATTCGAAACCCTAAAGCAGAGAAAGACGCTTACAACGAGTGGAACTACAGCAAGTTCAGACTA
TGGCAACTCACTGACTACGACAAAATCATCTTCATAGATGCAGATCTCTTAATCTTGAGAAACATCGACTTCTTGTTCTC
GATGCCTGAGATCTCAGCTACGGGAAACAATGGCACTCTGTTTAACTCGGGAGTTATGGTGATCGAGCCTTGCAACTGCA
CGTTTCAGCTTTTGATGGAACATATAAACGAGATTGAGTCGTACAACGGTGGAGATCAAGGTTACTTGAACGAGGTGTTC
ACGTGGTGGCATCGGATTCCGAAACACATGAATTTCTTGAAGCATTTTTGGGTTGGGGATGAAGATGACGTGAAGCGCAA
GAAAACGGAGTTGTTTGGAGCAGAGCCTCCTATTCTTTATGTTCTTCATTACCTGGGGATGAAGCCATGGCTATGTTACC
GTGACTATGACTGTAACTTCAACTCCGACATATTCGTTGAGTTTGCGACAGATATTGCTCACCGACGATGGTGGATGGTC
CACGACGCAATGCCACAGGAGCTTCATCAATTTTGTTACTTGCGATCCAAGCAAAAGGCTCAGCTGGAATATGATCGCCG
GCAAGCCGAGGCTGCGAACTATGCCGACGGCCACTGGAAAATAAGAGTAAAGGACAAGAGATTCAAGATTTGCATCGATA
AACTGTGTAACTGGAAAAGCATGTTGCGGCATTGGGGAGAATCAAACTGGACCGACTACGAGTCTTTTGTACCAACACCA
CCGGCCATCACCGCCGTCCGGAAAACCTCGCTTCCCGGCCATAACTTGTGA