Details for Chinese cabbage Locus Brara.E02329

Position : A05 ( 5`- 21088158 .. 21091027 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02329

Protein [Map View]
MDTEKGYPRGFRADSIRTETGRGSFRSDSMQFDEPHELPQENSTNLVLFKHIDSGNLEATKDFLDRNPEAITASLTSNGD
RPIHKAVLSGHIKIVEEIVKRIHHPVEELVIKNDDGYTALAYAATGGIVRIAECLVKKCPRLVSVRNAKEHIPIVLASLY
GHKDLVRYLYSHTLLSDLDPCDESDEHKGKNGAMLVTNCIVDGLYGIALDLIQRYPKLAYTRDSDNDTAIIALAQTPCAF
PSGTHLAFWQRWVYSCIHIEKINNPHDGLNDYHHQYKKPQDHNWIQEKLLKYLRFFFPHIRKVYKLKLGHAQAKEILNCI
CQEIPNFDATQQKNAGLNQALFKAVENGIVEYIEEVMKHYPDIVWFKDNYGLNLFFYAVSHRQEKIFSLIYKMGAKKNIL
ATAWDKLHNNMLHHAAYKAPVSRLNLIPGAALQMQRELQWFKEVERLVQPKHRKMVNLKQKKTPQALFKDQHKELVDQGE
KWMKDTATSCTVVAALITTMMFSSAFTVPDSYNGQGRLFMIFLISDAISLFTSCMSLLMFLGILKSRYREEDFLRSLPTK
LIVGLATLFLSMTTMMVSFVVTLMTLVRGKTPWVSAQFMVLAVVPIGMFGVLQFPVLLEIFCSTYFPKVFDKPRESRRVS
KLCWRK*

DNA
ATGGATACCGAAAAAGGCTATCCCAGAGGTTTCAGAGCCGACAGTATACGAACAGAAACCGGCCGTGGTAGCTTCCGGTC
AGATAGTATGCAGTTCGATGAGCCGCACGAGCTACCACAAGAGAATTCGACTAATCTCGTCCTCTTCAAGCACATAGACA
GTGGTAACTTGGAAGCCACGAAAGATTTCTTGGACCGAAACCCTGAGGCTATAACCGCAAGTTTAACCTCTAACGGAGAC
AGACCGATCCACAAAGCTGTTTTGTCTGGTCACATCAAGATCGTGGAAGAGATCGTTAAACGAATTCACCATCCAGTGGA
AGAGTTGGTGATCAAGAACGATGACGGTTACACGGCGCTTGCTTATGCTGCGACAGGTGGGATTGTCAGAATCGCAGAGT
GTTTGGTGAAGAAATGCCCTCGTTTGGTTAGTGTTCGGAATGCTAAAGAACATATACCGATCGTGCTGGCTTCCTTATAC
GGTCACAAAGATTTGGTTCGGTATCTTTACAGTCACACACTTCTCAGTGATCTTGATCCTTGTGATGAATCAGATGAACA
CAAGGGCAAGAACGGAGCGATGCTCGTGACAAACTGTATTGTCGATGGACTATATGGTATTGCTTTGGATCTGATTCAGA
GGTATCCTAAGCTGGCTTATACTAGAGACAGCGATAACGATACAGCGATCATTGCGCTTGCTCAAACGCCTTGTGCGTTC
CCTAGCGGTACCCATCTTGCGTTTTGGCAACGTTGGGTATATTCTTGTATTCACATAGAGAAGATTAATAACCCTCATGA
CGGTCTGAATGATTATCACCATCAATACAAGAAACCACAAGATCATAATTGGATTCAAGAGAAACTGTTAAAATACCTCA
GATTTTTTTTTCCACACATAAGAAAAGTATACAAACTAAAGCTAGGGCATGCTCAAGCCAAAGAGATACTAAACTGTATC
TGCCAAGAGATACCTAACTTTGACGCCACTCAACAGAAGAATGCTGGTCTCAACCAAGCTCTCTTCAAGGCGGTAGAGAA
TGGTATTGTCGAGTATATCGAGGAAGTGATGAAGCATTATCCTGATATCGTATGGTTCAAAGATAATTATGGTCTTAACC
TCTTTTTCTATGCGGTAAGCCATAGGCAAGAGAAGATCTTTAGCCTCATTTACAAAATGGGCGCCAAGAAAAACATCCTT
GCTACAGCTTGGGACAAACTCCATAATAATATGCTTCATCACGCCGCGTATAAAGCCCCAGTTTCAAGGCTTAATCTCAT
TCCTGGTGCTGCTCTTCAGATGCAAAGAGAACTACAGTGGTTTAAGGAAGTGGAGAGGCTAGTGCAACCGAAGCATCGAA
AAATGGTTAACTTGAAGCAGAAGAAAACTCCACAGGCTCTCTTTAAAGACCAGCACAAGGAGCTAGTGGACCAAGGAGAG
AAGTGGATGAAAGACACAGCCACTTCTTGCACAGTCGTCGCAGCTCTGATCACCACAATGATGTTCTCCTCCGCCTTTAC
TGTCCCCGATAGTTACAACGGCCAGGGCAGACTCTTCATGATCTTCCTAATCTCAGACGCTATATCTCTCTTCACCTCAT
GCATGTCTCTGCTCATGTTCCTCGGCATTCTTAAGTCTCGTTACCGCGAGGAGGACTTCCTTAGATCGCTTCCGACGAAA
CTGATCGTGGGTCTTGCGACTTTGTTTCTCTCGATGACGACAATGATGGTGAGTTTTGTCGTGACGCTTATGACTCTGGT
TAGAGGGAAAACGCCGTGGGTTTCGGCTCAGTTTATGGTTCTCGCGGTTGTCCCGATTGGGATGTTCGGTGTTCTTCAGT
TTCCTGTGCTACTTGAGATCTTCTGCTCGACTTACTTCCCTAAGGTTTTTGATAAGCCTCGCGAGTCTCGGCGAGTGTCT
AAGCTCTGCTGGAGAAAATGA