Details for Chinese cabbage Locus Brara.E02328

Position : A05 ( 5`- 21084485 .. 21086540 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02328

Protein [Map View]
MAIPLPLTSYSPISTSSSIPRTSFVPLTPRHRNFFSEQNFSRRVLISCSSSSSSNNGSTPESMNGSGLKGQSSFPGMPSF
DGTTSKPPVKWRRVLLKVSGEALAGDEEQNIDPKVTMAIAREVAAVTRLGIEVAIVVGGGNIFRGSTWAGCSGLDRSSAD
YIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAIRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEIN
AEVVLKATNVDGVFDDDPKRNPNARLHESLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLSEPGNIAKAIKGERVGT
LIGGTWNSTVAAT*

DNA
ATGGCGATTCCGTTGCCCCTCACTTCCTACTCCCCAATCTCAACTTCTTCTTCTATTCCCCGAACCTCTTTCGTCCCTCT
CACGCCTCGCCATCGTAATTTCTTCTCCGAACAGAACTTCAGTAGGCGCGTACTTATCAGCTGCTCTTCGTCTTCGTCAT
CGAACAACGGTTCAACTCCAGAGTCCATGAACGGGAGTGGGTTAAAGGGGCAGTCATCGTTTCCTGGAATGCCTTCCTTT
GATGGAACAACATCTAAGCCACCGGTTAAGTGGAGAAGGGTTTTGCTTAAAGTCAGTGGAGAAGCTCTTGCTGGAGACGA
GGAGCAGAATATCGATCCAAAGGTTACTATGGCTATTGCAAGGGAGGTTGCAGCAGTGACTCGTCTTGGCATTGAGGTTG
CGATTGTTGTTGGAGGAGGAAACATCTTCCGTGGATCCACCTGGGCTGGGTGCAGTGGCCTTGACCGCTCCTCTGCTGAT
TACATCGGGATGCTGGCAACTGTGATGAACGCAATATTTCTCCAAGCGACAATGGAGAGCATCGGCATCCCAACACGTGT
TCAAACCGCTTTCCGCATGTCGGAAGTCGCAGAGCCTTACATCAGAAGACGAGCCATTAGACATCTAGAAAAAGGCAGGG
TTGTGATATTCGCAGCCGGAACAGGCAATCCGTTCTTCACTACCGATACTGCAGCAGCTCTTCGATGTGCCGAGATTAAC
GCAGAAGTAGTACTGAAAGCAACAAATGTAGATGGAGTCTTCGACGATGATCCCAAGAGAAACCCAAACGCTCGCCTCCA
CGAGTCACTAACTTACCAAGAAGTAACCTCAAAGGATCTCTCCGTGATGGACATGACTGCTATCACTTTGTGCCAAGAAA
ACAACATCCCAGTTGTGGTCTTTAATTTGTCTGAGCCTGGAAACATCGCGAAAGCCATCAAAGGAGAGAGAGTTGGTACA
TTGATTGGAGGAACATGGAACTCTACTGTTGCAGCCACATGA