Details for Chinese cabbage Locus Brara.E02326

Position : A05 ( 5`- 21078203 .. 21079793 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02326

Protein [Map View]
MGRDETETYITVPTFFKCPISLDVMRSPVSLCTGVTYDRPSIQRWLDGGNNTCPATMQILNSKDLVPNLTLQRLIKAWSD
SVGSSPAASSPDPASARGIPTVEEVNDSLMRLSQEKDDEIRLEILTRIVRFVKDSEANREFLSGKEDLVPMLVDIVSAVK
TAKIKLAILAIKILDSIIKKCNEGDRERLSKLMLLTNGGDCLTAILLAIQRGDLESKIEAVSVLEVIASHDAKSKMMIAE
REGILTELIKSISTESDPNLIEASLSFLITISKSKRVRSKLIAAKTITRIKDILLTEETISVAVTEKSLKLLEVLSSKRE
GRSEICGGNGDCVEGVVKKLLKVSTTATEHAVTILWCLCHVFKEDKTVEETVERSNGVTKLLVVIQSNCSPMVRQMAKDL
IKVLKVKSSASALAAYQTKTTHIMPF*

DNA
ATGGGGAGAGATGAAACCGAGACGTACATTACGGTGCCTACCTTCTTCAAGTGTCCGATATCTCTCGACGTGATGAGATC
TCCCGTTAGTCTCTGCACCGGCGTCACCTACGATCGTCCAAGTATCCAGCGGTGGCTCGACGGAGGCAACAACACTTGTC
CCGCCACTATGCAGATTCTCAATTCAAAGGATCTCGTTCCTAACCTCACTCTCCAACGGCTTATCAAAGCCTGGTCCGAC
TCCGTCGGTAGTTCCCCCGCCGCTAGCTCTCCGGATCCGGCGTCTGCTCGAGGGATCCCGACGGTGGAAGAAGTGAATGA
TTCGTTGATGAGACTGAGTCAAGAGAAGGACGACGAGATTCGTCTGGAGATTCTAACGAGAATCGTTCGGTTCGTTAAGG
ATTCGGAAGCGAACAGAGAGTTTCTCTCCGGGAAAGAGGATCTCGTACCAATGCTCGTCGATATCGTCTCCGCCGTGAAG
ACGGCGAAGATCAAGCTAGCTATTCTAGCGATTAAGATTTTGGATAGTATAATCAAGAAATGTAACGAGGGAGATCGAGA
ACGGTTATCGAAACTGATGTTGTTGACCAACGGTGGAGATTGCTTGACGGCGATTCTCCTCGCGATTCAGCGCGGGGATC
TAGAATCGAAGATCGAAGCCGTTAGTGTTTTGGAGGTTATCGCATCCCACGACGCGAAATCGAAGATGATGATCGCAGAG
CGCGAGGGGATTCTAACGGAGCTGATCAAATCAATCAGCACAGAGTCGGATCCTAATTTGATAGAAGCGAGTCTATCATT
CCTAATCACAATCTCGAAATCGAAACGAGTGAGATCGAAACTAATCGCGGCGAAAACGATCACGAGGATCAAGGACATTC
TACTAACGGAGGAGACGATAAGCGTCGCGGTGACGGAGAAGTCTCTGAAGCTGTTGGAGGTACTATCGTCAAAGCGGGAA
GGTAGATCGGAGATTTGCGGCGGAAACGGAGATTGCGTGGAGGGAGTGGTGAAGAAGCTGTTGAAAGTATCGACGACGGC
GACGGAGCACGCCGTGACGATTTTGTGGTGTCTGTGCCACGTGTTTAAGGAAGATAAGACGGTGGAGGAGACGGTGGAGA
GAAGTAACGGCGTGACGAAGCTGTTAGTGGTGATTCAGAGCAACTGCTCGCCGATGGTGAGACAAATGGCGAAAGATCTG
ATAAAGGTTTTGAAGGTTAAGTCATCTGCTTCTGCTTTGGCTGCTTACCAGACCAAGACCACTCATATTATGCCATTTTG
A