Details for Chinese cabbage Locus Brara.E02323

Position : A05 ( 5`- 21061189 .. 21061470 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02323

Protein [Map View]
MVTTHQHYWMKRLSINPQALLLLFFCFFFIHHCDASRALSPSSVFYIIPNDDHNKNTMRRDHFFGILPRHLPVPASGPSR
KHNDIGLQALLSP*

DNA
ATGGTTACTACACATCAACATTATTGGATGAAAAGGTTATCAATAAACCCACAAGCTCTTCTTCTTCTGTTCTTCTGCTT
CTTCTTCATTCACCATTGCGACGCCTCGAGAGCCTTGTCACCATCAAGCGTTTTCTACATAATCCCTAATGATGATCACA
ACAAAAACACTATGAGGAGAGACCATTTCTTTGGAATCTTGCCAAGACACTTACCTGTTCCGGCTTCTGGTCCTTCACGA
AAACACAACGACATTGGTCTACAAGCATTGTTGTCTCCATGA