Details for Chinese cabbage Locus Brara.E02321

Position : A05 ( 5`- 21052595 .. 21053270 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02321

Protein [Map View]
MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYYAMLAKVGVHHYNGNNVD
LGTACGKYFRVSCLSIVDPGDSDIIKSLPGDQ*

DNA
ATGGTTGCGGCGAAGAAGACGAAGAAGTCCCATGAGGGAATCAACAGCAGACTAGCTCTTGTCATGAAGAGTGGAAAGTA
CACTCTAGGCTACAAATCCGTTCTCAAGTCCCTTCGCAGCTCCAAAGGTAAGTTGATTCTTATCTCGAGCAACTGCCCTC
CGTTGAGGAGATCAGAGATTGAGTACTACGCTATGCTTGCTAAAGTTGGTGTTCATCACTACAATGGCAACAATGTCGAT
TTGGGAACTGCTTGTGGAAAGTACTTCCGTGTTTCTTGCCTCAGCATTGTTGATCCAGGTGATTCCGACATCATCAAGTC
GCTTCCAGGAGACCAGTGA