Details for Chinese cabbage Locus Brara.E02319

Position : A05 ( 5`- 21042549 .. 21049933 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02319

Protein [Map View]
MNRSSNSEGAKAEKIIFEFFAKTLHIILESRTPFMSSRNFSSSGEQIMNSPSSSSSSSSSVRPRDKWFNLALRECPAALE
SFDISRRSTLEPLVVDVVLVARPFDQMNSPGGRELIRNFSGKEYHSDQDDCEGKNEQIIERWVVQYDNRKVRERRSSSNN
NNNKLQVMYKKATLLLRSLFVMVRLLPAYKIFRELNSSGQIFKFELVPKVPTISPPFTRREEGEMHKFAFMPVDTICGRL
CMSVLYRSLSESDVSCSQHSAPLSPTFITDYVGSPLADPLKSFPSLPLSYGSPPLMSFERRHSWSFDRCKASSPPPSVSC
SPSPTRSDPQAICLQDFSPPCSPSEPTQAVPRSITRTESAPVRIPPPTFESKQNVVVPPSSHLKLSRHASLKPVRNTGPV
ESGVRLSTNSSPRISFSRSSSRSYQDDFDDTDFPCPFDVEYDEITDPSSSRPGSLDQRGDIHEPPPFESSGSYPKKSQDA
GVGALVNMLKKAPPLRQDVSETSTPELCWNNNKNKPGGDQEIAIITTTASMTASGIALAAKTTADALEELRSYKEMKNVL
LSQSTKDSSSPFAV*

DNA
ATGAACAGGAGTAGCAACTCCGAAGGTGCTAAAGCAGAGAAGATCATATTCGAGTTCTTCGCCAAAACCCTCCACATCAT
CCTCGAATCAAGGACTCCTTTCATGTCTTCAAGAAACTTCAGTAGTAGCGGCGAGCAGATAATGAACTCACCTTCCTCAT
CTTCTTCGTCTTCCTCCAGCGTCAGGCCTCGTGACAAATGGTTCAACCTAGCTCTCAGGGAGTGTCCTGCAGCGTTAGAG
AGCTTCGACATCAGCCGCAGAAGCACGTTAGAGCCTCTGGTTGTCGATGTGGTTCTTGTGGCGAGACCATTTGATCAGAT
GAATTCTCCAGGTGGGAGAGAGCTTATCAGGAACTTCTCCGGGAAAGAGTATCACTCTGATCAAGATGATTGTGAGGGCA
AGAACGAGCAGATCATTGAGAGATGGGTTGTGCAGTATGATAATAGGAAGGTTAGAGAAAGGAGGTCAAGTAGTAATAAT
AATAATAATAAGTTGCAAGTGATGTATAAGAAAGCAACTTTGTTACTGAGATCACTCTTTGTAATGGTTAGGCTTTTACC
TGCTTACAAGATCTTCAGAGAACTCAACTCATCTGGACAAATCTTCAAGTTCGAGCTTGTCCCTAAGGTTCCAACCATAA
GCCCTCCATTTACTCGTAGAGAAGAGGGAGAGATGCACAAGTTCGCTTTCATGCCGGTTGATACCATCTGCGGTAGGCTT
TGCATGTCGGTGTTGTATCGATCTCTCTCGGAGTCGGATGTCAGTTGCAGCCAACACTCAGCTCCTTTGTCTCCGACCTT
TATTACTGATTACGTTGGAAGTCCTTTAGCTGATCCTTTGAAAAGTTTCCCTTCTCTGCCTCTTTCTTATGGCTCGCCGC
CGTTGATGTCGTTTGAGAGGCGTCATAGCTGGAGTTTTGATCGTTGCAAGGCCTCTTCTCCACCTCCTTCGGTTTCTTGC
TCACCGTCGCCTACACGGTCTGATCCACAAGCAATTTGTTTGCAAGATTTTTCTCCTCCTTGTTCTCCGTCAGAACCTAC
ACAAGCCGTCCCGAGAAGCATCACGCGTACTGAAAGTGCTCCAGTTAGGATTCCACCTCCTACTTTTGAGTCTAAACAGA
ACGTGGTGGTGCCACCTTCTTCTCATTTGAAACTGTCGAGACATGCTTCTTTGAAGCCTGTGAGAAACACTGGTCCTGTT
GAATCTGGGGTGAGGCTATCTACCAACAGCTCACCGAGGATATCATTTTCTAGAAGTTCAAGTAGATCATACCAAGATGA
TTTTGATGATACTGATTTCCCTTGTCCATTTGATGTTGAGTATGACGAAATTACAGATCCTAGTAGTAGCAGACCAGGCT
CCTTGGACCAGAGAGGAGATATACATGAACCACCACCATTTGAGTCGAGCGGTTCATACCCAAAGAAGTCACAAGATGCA
GGAGTCGGTGCTCTAGTGAATATGCTGAAGAAAGCTCCACCTCTCAGACAAGACGTCTCTGAAACTTCCACACCTGAACT
TTGTTGGAACAACAACAAGAACAAACCTGGAGGGGATCAGGAGATAGCTATCATCACAACAACGGCCTCTATGACAGCGT
CAGGGATAGCTCTGGCGGCAAAGACAACAGCCGATGCCTTGGAAGAGCTGAGGTCTTACAAAGAAATGAAGAATGTGTTG
CTTAGCCAATCCACAAAGGACTCGTCCTCACCCTTTGCTGTTTGA