Details for Chinese cabbage Locus Brara.E02317

Position : A05 ( 5`- 21031478 .. 21032125 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02317

Protein [Map View]
MSAETFAPIIYEDFLENFYSRRLLLHRAYQPPTMASPPFGDAHEASHSHAHQMSFDANVVMVLSVLLCALVCSLGLHSII
RCLLRYSSEASEELTVRMANTGVKRKALKSFQTVSYSTEMNLPGLDTECAICLSEFVSGERVKLLPKCHHGFHVRCIDKW
LSSHSSCPTCRDCLIQTCQKIAGCSETTSSSNQPPQGSFSVHIAPLGPERFIHGF*

DNA
ATGTCGGCTGAAACATTTGCTCCCATTATCTATGAAGATTTTCTTGAGAACTTTTACTCAAGAAGGCTACTACTTCACAG
AGCTTATCAACCACCTACCATGGCATCTCCTCCATTTGGAGACGCTCATGAAGCATCACACTCTCATGCACATCAAATGA
GCTTTGATGCAAATGTTGTTATGGTCTTATCAGTCCTCTTGTGTGCACTAGTTTGCTCACTTGGACTGCATTCTATCATT
AGATGTCTGCTGAGGTACTCATCTGAAGCTAGTGAGGAGCTTACAGTTCGCATGGCCAACACAGGGGTCAAACGAAAAGC
CTTGAAGAGTTTCCAGACGGTAAGTTACTCTACAGAGATGAATCTGCCTGGTCTTGATACAGAGTGTGCTATATGTCTCT
CGGAGTTTGTGTCCGGAGAGCGAGTCAAGCTTCTGCCAAAGTGCCACCATGGGTTCCATGTTCGGTGTATAGACAAATGG
CTAAGTTCACACTCATCATGTCCCACTTGCAGAGACTGTCTCATTCAGACTTGCCAAAAGATAGCTGGGTGCAGTGAGAC
GACCTCATCATCTAATCAACCACCACAGGGAAGCTTTAGCGTGCATATAGCACCGCTAGGACCAGAAAGATTCATACACG
GCTTCTGA